Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6S445

Protein Details
Accession A0A2R6S445    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-29LPLVRTCSSQHKKTCRKCGHLTRFGKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MPLPLVRTCSSQHKKTCRKCGHLTRFGKSATYRTGSVSKGWGGGWVLVMLVSPVHFKLRDDLGRLGQDVDKSDIDTAVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.84
4 0.83
5 0.83
6 0.85
7 0.87
8 0.86
9 0.86
10 0.81
11 0.74
12 0.68
13 0.61
14 0.54
15 0.44
16 0.37
17 0.31
18 0.28
19 0.25
20 0.23
21 0.26
22 0.24
23 0.23
24 0.21
25 0.17
26 0.15
27 0.14
28 0.12
29 0.1
30 0.09
31 0.08
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.03
38 0.03
39 0.04
40 0.05
41 0.07
42 0.08
43 0.09
44 0.12
45 0.19
46 0.22
47 0.26
48 0.28
49 0.31
50 0.32
51 0.32
52 0.31
53 0.26
54 0.25
55 0.23
56 0.24
57 0.2
58 0.19
59 0.19