Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8Y0G9

Protein Details
Accession G8Y0G9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAQRITYRRRNPYNTRSNKIKVHydrophilic
NLS Segment(s)
PositionSequence
111-121KEKKASQKSKK
Subcellular Location(s) mito 16, nucl 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRITYRRRNPYNTRSNKIKVVKTPGGKLVAQHVKKSGSRVNCGDCGQALAGISSLRPRQYASVSKTHKTVQRAYGGSRCANCVKDRVVRAFLIEEQKIVKSVLKDQQAKEKKASQKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.82
4 0.77
5 0.77
6 0.74
7 0.71
8 0.67
9 0.66
10 0.66
11 0.62
12 0.61
13 0.57
14 0.53
15 0.46
16 0.4
17 0.4
18 0.42
19 0.39
20 0.37
21 0.35
22 0.35
23 0.36
24 0.4
25 0.36
26 0.32
27 0.35
28 0.37
29 0.38
30 0.37
31 0.36
32 0.32
33 0.26
34 0.22
35 0.17
36 0.14
37 0.1
38 0.06
39 0.06
40 0.05
41 0.05
42 0.07
43 0.08
44 0.08
45 0.08
46 0.09
47 0.1
48 0.15
49 0.21
50 0.23
51 0.31
52 0.34
53 0.35
54 0.37
55 0.39
56 0.39
57 0.37
58 0.38
59 0.34
60 0.37
61 0.37
62 0.38
63 0.38
64 0.37
65 0.36
66 0.32
67 0.3
68 0.26
69 0.27
70 0.25
71 0.25
72 0.26
73 0.3
74 0.33
75 0.34
76 0.34
77 0.32
78 0.32
79 0.31
80 0.3
81 0.3
82 0.26
83 0.23
84 0.21
85 0.21
86 0.21
87 0.2
88 0.19
89 0.15
90 0.22
91 0.28
92 0.36
93 0.42
94 0.43
95 0.53
96 0.6
97 0.62
98 0.61
99 0.62
100 0.63
101 0.67