Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6R7B4

Protein Details
Accession A0A2R6R7B4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-70QPLIPQRKWDWKGKKKGESLRAGPKPHydrophilic
NLS Segment(s)
PositionSequence
54-70DWKGKKKGESLRAGPKP
Subcellular Location(s) mito 21.5, cyto_mito 12, pero 2
Family & Domain DBs
Amino Acid Sequences MAGTYLKRDPAIDSFSLLYLRPYTTSPKTKTCVHLALVVFTEIAQPLIPQRKWDWKGKKKGESLRAGPKPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.18
5 0.16
6 0.12
7 0.12
8 0.11
9 0.12
10 0.18
11 0.24
12 0.32
13 0.34
14 0.38
15 0.42
16 0.44
17 0.47
18 0.46
19 0.42
20 0.35
21 0.36
22 0.31
23 0.28
24 0.24
25 0.2
26 0.15
27 0.12
28 0.11
29 0.05
30 0.05
31 0.04
32 0.04
33 0.09
34 0.17
35 0.17
36 0.19
37 0.24
38 0.34
39 0.38
40 0.49
41 0.55
42 0.58
43 0.69
44 0.76
45 0.81
46 0.8
47 0.85
48 0.84
49 0.82
50 0.8
51 0.8
52 0.77