Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6S4C3

Protein Details
Accession A0A2R6S4C3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
36-61YDPGPPPPPRDPKKQKEQKGKSKDVDBasic
NLS Segment(s)
PositionSequence
42-58PPPRDPKKQKEQKGKSK
152-171GSHGMNRRGGRGGGGRGFRG
Subcellular Location(s) nucl 11, cyto_nucl 9, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MTPRPLPVYYSFDLVEGYAYQPSVEPVLWHPFNPLYDPGPPPPPRDPKKQKEQKGKSKDVDGAGPAAGAARSPPRATVHLPPPGLSHPYNAYARLGVPVAGPSARGGRFARGRGYPPSQQQRNVESNASAATNGFVPRPPENPASPRQHSRGSHGMNRRGGRGGGGRGFRGGGPWPVSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.12
4 0.12
5 0.09
6 0.09
7 0.09
8 0.09
9 0.1
10 0.1
11 0.1
12 0.1
13 0.12
14 0.21
15 0.22
16 0.22
17 0.24
18 0.24
19 0.25
20 0.27
21 0.26
22 0.2
23 0.23
24 0.26
25 0.26
26 0.33
27 0.34
28 0.36
29 0.42
30 0.5
31 0.52
32 0.6
33 0.67
34 0.67
35 0.77
36 0.82
37 0.83
38 0.84
39 0.89
40 0.89
41 0.88
42 0.88
43 0.8
44 0.74
45 0.69
46 0.59
47 0.5
48 0.4
49 0.31
50 0.22
51 0.18
52 0.13
53 0.09
54 0.07
55 0.05
56 0.05
57 0.06
58 0.08
59 0.08
60 0.1
61 0.12
62 0.15
63 0.18
64 0.23
65 0.27
66 0.31
67 0.31
68 0.29
69 0.29
70 0.28
71 0.29
72 0.23
73 0.18
74 0.14
75 0.18
76 0.18
77 0.17
78 0.16
79 0.12
80 0.12
81 0.12
82 0.1
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.09
91 0.09
92 0.12
93 0.12
94 0.17
95 0.21
96 0.22
97 0.25
98 0.24
99 0.27
100 0.29
101 0.34
102 0.33
103 0.39
104 0.47
105 0.48
106 0.51
107 0.52
108 0.53
109 0.52
110 0.5
111 0.42
112 0.33
113 0.29
114 0.25
115 0.21
116 0.15
117 0.1
118 0.08
119 0.09
120 0.09
121 0.09
122 0.1
123 0.13
124 0.16
125 0.18
126 0.22
127 0.25
128 0.28
129 0.33
130 0.39
131 0.44
132 0.48
133 0.52
134 0.52
135 0.56
136 0.54
137 0.56
138 0.57
139 0.55
140 0.58
141 0.6
142 0.64
143 0.63
144 0.64
145 0.59
146 0.53
147 0.47
148 0.42
149 0.39
150 0.37
151 0.35
152 0.36
153 0.34
154 0.32
155 0.33
156 0.29
157 0.26
158 0.23
159 0.22