Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y170

Protein Details
Accession G8Y170    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
155-176SSKSPEPSKYKVNKPSKSKKKNHydrophilic
NLS Segment(s)
PositionSequence
146-176KKSAKSKDGSSKSPEPSKYKVNKPSKSKKKN
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MENIEKVRKFAQVFDESVNDFNKGVDPILRKTLDELATSDDALKSLKAYNTYGYILISSLYAYLKSTGTDTKDHPIMKELDRIKLYMKKAKDIESRMASKDSADKNSSSVLKSILGKDTEPRSPAISSSNFKGTHTKFEDSTKYEKKSAKSKDGSSKSPEPSKYKVNKPSKSKKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.33
4 0.34
5 0.31
6 0.24
7 0.19
8 0.17
9 0.17
10 0.14
11 0.14
12 0.16
13 0.19
14 0.21
15 0.28
16 0.28
17 0.26
18 0.28
19 0.33
20 0.3
21 0.28
22 0.25
23 0.23
24 0.23
25 0.23
26 0.21
27 0.15
28 0.13
29 0.13
30 0.12
31 0.08
32 0.1
33 0.12
34 0.14
35 0.15
36 0.16
37 0.18
38 0.19
39 0.18
40 0.15
41 0.14
42 0.11
43 0.1
44 0.08
45 0.06
46 0.05
47 0.05
48 0.05
49 0.06
50 0.07
51 0.07
52 0.07
53 0.09
54 0.11
55 0.13
56 0.15
57 0.16
58 0.19
59 0.23
60 0.23
61 0.22
62 0.23
63 0.23
64 0.22
65 0.28
66 0.25
67 0.26
68 0.26
69 0.26
70 0.26
71 0.28
72 0.3
73 0.29
74 0.28
75 0.29
76 0.31
77 0.36
78 0.39
79 0.37
80 0.39
81 0.39
82 0.4
83 0.36
84 0.35
85 0.29
86 0.24
87 0.27
88 0.24
89 0.23
90 0.23
91 0.21
92 0.21
93 0.24
94 0.25
95 0.19
96 0.17
97 0.14
98 0.15
99 0.17
100 0.18
101 0.18
102 0.17
103 0.17
104 0.21
105 0.24
106 0.24
107 0.23
108 0.23
109 0.22
110 0.21
111 0.21
112 0.22
113 0.23
114 0.23
115 0.24
116 0.3
117 0.28
118 0.29
119 0.36
120 0.33
121 0.38
122 0.4
123 0.4
124 0.36
125 0.41
126 0.46
127 0.41
128 0.49
129 0.47
130 0.47
131 0.5
132 0.53
133 0.54
134 0.58
135 0.62
136 0.63
137 0.62
138 0.66
139 0.7
140 0.72
141 0.72
142 0.7
143 0.69
144 0.66
145 0.67
146 0.66
147 0.61
148 0.6
149 0.65
150 0.66
151 0.68
152 0.71
153 0.74
154 0.76
155 0.81
156 0.88