Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6S6W3

Protein Details
Accession A0A2R6S6W3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-51PVAPGRARKVSRRKIKKPKRARKRKPDIQWSTPWBasic
96-115AWLKNSAPLKRKKRFICDMRHydrophilic
NLS Segment(s)
PositionSequence
21-43PGRARKVSRRKIKKPKRARKRKP
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MPVLRSGTCTARNVSALPVAPGRARKVSRRKIKKPKRARKRKPDIQWSTPWMGSLPMTRYESKEKRKRLLANLSSPKSKKSFEGVSQVAMSRSMAAWLKNSAPLKRKKRFICDMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.21
4 0.21
5 0.19
6 0.18
7 0.2
8 0.22
9 0.24
10 0.28
11 0.31
12 0.38
13 0.48
14 0.56
15 0.65
16 0.72
17 0.8
18 0.84
19 0.91
20 0.93
21 0.93
22 0.94
23 0.95
24 0.95
25 0.95
26 0.95
27 0.95
28 0.94
29 0.93
30 0.93
31 0.89
32 0.84
33 0.78
34 0.72
35 0.64
36 0.54
37 0.44
38 0.33
39 0.25
40 0.19
41 0.16
42 0.13
43 0.13
44 0.15
45 0.16
46 0.18
47 0.26
48 0.33
49 0.42
50 0.48
51 0.51
52 0.55
53 0.62
54 0.65
55 0.64
56 0.68
57 0.63
58 0.65
59 0.68
60 0.65
61 0.64
62 0.59
63 0.54
64 0.46
65 0.42
66 0.34
67 0.31
68 0.34
69 0.32
70 0.39
71 0.37
72 0.36
73 0.35
74 0.34
75 0.28
76 0.22
77 0.18
78 0.11
79 0.1
80 0.11
81 0.12
82 0.12
83 0.14
84 0.16
85 0.17
86 0.23
87 0.28
88 0.32
89 0.39
90 0.48
91 0.57
92 0.64
93 0.72
94 0.74
95 0.79