Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6RVF8

Protein Details
Accession A0A2R6RVF8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
101-122ASAVKNKTEQRRERKAVRGYKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
Amino Acid Sequences MAALFLRLRANPLKLSPKLHTSLIRNAATSSSETASSSEPLTHYRITLRRSAISLPSHIKGTLVSLGIHRRLQTVYHEHSPINAGKILRVKELVEVENVPASAVKNKTEQRRERKAVRGYKVVGSSLLSATP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.45
4 0.46
5 0.46
6 0.47
7 0.47
8 0.43
9 0.47
10 0.5
11 0.47
12 0.41
13 0.39
14 0.35
15 0.31
16 0.27
17 0.21
18 0.14
19 0.13
20 0.13
21 0.14
22 0.14
23 0.14
24 0.13
25 0.11
26 0.11
27 0.13
28 0.16
29 0.15
30 0.14
31 0.19
32 0.23
33 0.24
34 0.28
35 0.29
36 0.27
37 0.28
38 0.29
39 0.28
40 0.25
41 0.26
42 0.24
43 0.23
44 0.22
45 0.21
46 0.19
47 0.14
48 0.14
49 0.12
50 0.09
51 0.08
52 0.09
53 0.12
54 0.14
55 0.15
56 0.14
57 0.13
58 0.13
59 0.14
60 0.16
61 0.2
62 0.23
63 0.25
64 0.26
65 0.25
66 0.25
67 0.27
68 0.23
69 0.19
70 0.17
71 0.14
72 0.15
73 0.2
74 0.21
75 0.19
76 0.2
77 0.18
78 0.19
79 0.22
80 0.2
81 0.17
82 0.17
83 0.16
84 0.16
85 0.15
86 0.12
87 0.1
88 0.1
89 0.14
90 0.15
91 0.16
92 0.23
93 0.29
94 0.39
95 0.49
96 0.58
97 0.62
98 0.71
99 0.77
100 0.78
101 0.82
102 0.82
103 0.81
104 0.78
105 0.76
106 0.68
107 0.66
108 0.61
109 0.52
110 0.43
111 0.36
112 0.31