Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6RIJ0

Protein Details
Accession A0A2R6RIJ0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTKKRRNNGRNKKGRGHVTVVBasic
NLS Segment(s)
PositionSequence
3-15KKRRNNGRNKKGR
87-109RSREGRRNRAPPPRVRWKDGKKV
Subcellular Location(s) cyto 10.5, mito 10, cyto_nucl 9, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTKKRRNNGRNKKGRGHVTVVRCSNCSRVVGKDKAIKRFTVRNMVESAAVRDISEASIYPEYVIPKLYIKIAYCVSCAIHSHVVRVRSREGRRNRAPPPRVRWKDGKKVNPAVAAAEDAKAAAAGAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.8
3 0.76
4 0.72
5 0.69
6 0.69
7 0.65
8 0.58
9 0.52
10 0.47
11 0.44
12 0.39
13 0.35
14 0.28
15 0.3
16 0.36
17 0.37
18 0.42
19 0.46
20 0.49
21 0.54
22 0.54
23 0.49
24 0.46
25 0.5
26 0.48
27 0.51
28 0.46
29 0.4
30 0.39
31 0.37
32 0.35
33 0.27
34 0.25
35 0.16
36 0.15
37 0.12
38 0.1
39 0.1
40 0.08
41 0.08
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.08
53 0.09
54 0.1
55 0.1
56 0.1
57 0.12
58 0.14
59 0.14
60 0.13
61 0.14
62 0.13
63 0.12
64 0.13
65 0.13
66 0.18
67 0.17
68 0.2
69 0.23
70 0.27
71 0.28
72 0.3
73 0.33
74 0.36
75 0.42
76 0.47
77 0.54
78 0.59
79 0.66
80 0.71
81 0.74
82 0.76
83 0.78
84 0.79
85 0.78
86 0.8
87 0.77
88 0.76
89 0.77
90 0.76
91 0.79
92 0.79
93 0.79
94 0.77
95 0.79
96 0.77
97 0.7
98 0.61
99 0.52
100 0.43
101 0.37
102 0.28
103 0.21
104 0.16
105 0.12
106 0.11
107 0.09
108 0.08