Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NK08

Protein Details
Accession A0A2R6NK08    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-85RQCSHDCPCRNVNKKKQRRRRIFIIILIHydrophilic
NLS Segment(s)
PositionSequence
71-77KKKQRRR
Subcellular Location(s) plas 14, nucl 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRSSTPTRKDTESQSAASPSPRKSRFTKLMFDIRTMVREPQIVPMQPPPWPPLHVEKRQCSHDCPCRNVNKKKQRRRRIFIIILILIILYLLGNTVALNIRVFGSPPSAQPPHNSTASTSTALSSDAQQCLSQYTVNAPSNPGDYPCSTCLPVLQSVPSNFSDGNAQDTQQIENAVQFCGLRSIFETADSDGQSALKNGNWAQDVKFCAWDGVSCDGMGRVSSLSLTFPGVPGLLPSELGALSGLQSLTIIGNSATPCMFTSQPHVRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.43
4 0.45
5 0.43
6 0.39
7 0.44
8 0.46
9 0.48
10 0.5
11 0.59
12 0.62
13 0.62
14 0.64
15 0.62
16 0.68
17 0.64
18 0.61
19 0.56
20 0.47
21 0.44
22 0.38
23 0.33
24 0.26
25 0.26
26 0.25
27 0.27
28 0.32
29 0.29
30 0.3
31 0.33
32 0.32
33 0.33
34 0.35
35 0.3
36 0.27
37 0.28
38 0.29
39 0.34
40 0.41
41 0.48
42 0.53
43 0.58
44 0.6
45 0.67
46 0.66
47 0.61
48 0.61
49 0.62
50 0.6
51 0.59
52 0.62
53 0.64
54 0.71
55 0.76
56 0.78
57 0.79
58 0.83
59 0.88
60 0.91
61 0.92
62 0.93
63 0.91
64 0.89
65 0.88
66 0.83
67 0.77
68 0.71
69 0.6
70 0.49
71 0.4
72 0.3
73 0.2
74 0.13
75 0.09
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.03
83 0.04
84 0.05
85 0.05
86 0.05
87 0.07
88 0.07
89 0.07
90 0.07
91 0.1
92 0.1
93 0.11
94 0.17
95 0.18
96 0.18
97 0.21
98 0.25
99 0.24
100 0.25
101 0.24
102 0.19
103 0.22
104 0.23
105 0.22
106 0.17
107 0.14
108 0.13
109 0.14
110 0.13
111 0.11
112 0.11
113 0.11
114 0.11
115 0.11
116 0.11
117 0.11
118 0.11
119 0.09
120 0.07
121 0.08
122 0.14
123 0.15
124 0.15
125 0.15
126 0.15
127 0.16
128 0.16
129 0.15
130 0.11
131 0.11
132 0.14
133 0.15
134 0.16
135 0.15
136 0.15
137 0.15
138 0.15
139 0.16
140 0.13
141 0.12
142 0.14
143 0.14
144 0.17
145 0.16
146 0.16
147 0.14
148 0.14
149 0.15
150 0.12
151 0.17
152 0.14
153 0.14
154 0.15
155 0.16
156 0.16
157 0.14
158 0.14
159 0.09
160 0.11
161 0.12
162 0.09
163 0.09
164 0.09
165 0.08
166 0.1
167 0.1
168 0.08
169 0.09
170 0.12
171 0.11
172 0.12
173 0.13
174 0.12
175 0.15
176 0.15
177 0.13
178 0.11
179 0.11
180 0.11
181 0.1
182 0.1
183 0.08
184 0.1
185 0.11
186 0.14
187 0.16
188 0.17
189 0.18
190 0.21
191 0.23
192 0.22
193 0.23
194 0.2
195 0.18
196 0.17
197 0.17
198 0.16
199 0.16
200 0.15
201 0.13
202 0.13
203 0.13
204 0.13
205 0.12
206 0.09
207 0.06
208 0.06
209 0.07
210 0.07
211 0.07
212 0.08
213 0.1
214 0.09
215 0.09
216 0.1
217 0.09
218 0.09
219 0.09
220 0.11
221 0.09
222 0.09
223 0.09
224 0.1
225 0.09
226 0.09
227 0.09
228 0.06
229 0.07
230 0.08
231 0.08
232 0.06
233 0.06
234 0.07
235 0.07
236 0.07
237 0.07
238 0.05
239 0.09
240 0.09
241 0.11
242 0.1
243 0.11
244 0.12
245 0.15
246 0.16
247 0.15
248 0.23