Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6NG19

Protein Details
Accession A0A2R6NG19    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-62GNLGGLPKREKKQKMRDRVHYSEIHydrophilic
NLS Segment(s)
PositionSequence
47-50REKK
Subcellular Location(s) cyto 9, cysk 9, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
Amino Acid Sequences MTTCRSLTTYPSHVDPEEPIDLLNVAFENPRKIRVQAEGNLGGLPKREKKQKMRDRVHYSEIDVTYHVPDRVTGLQEVEELRRLCPGRIWNFVEINVPFEEYQIARPIVEEVMFPGRTVMDLSLAMALYFAAQGVGDIRSHPGAPAEPYTSSARVLLNGLGSDELLGGYGRFRTAYKAAGWQAIIDELPVHLKMDPRLEAGLGEKMLLRLAAHKVGLVEASRRKKRAMQFGSHSARMAPGAGDKKGDLLLSERIDLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.29
4 0.26
5 0.23
6 0.2
7 0.17
8 0.16
9 0.15
10 0.13
11 0.08
12 0.07
13 0.1
14 0.11
15 0.18
16 0.19
17 0.24
18 0.25
19 0.27
20 0.3
21 0.34
22 0.4
23 0.37
24 0.43
25 0.41
26 0.39
27 0.38
28 0.35
29 0.28
30 0.24
31 0.24
32 0.24
33 0.29
34 0.38
35 0.47
36 0.57
37 0.68
38 0.75
39 0.81
40 0.84
41 0.88
42 0.88
43 0.84
44 0.8
45 0.7
46 0.63
47 0.58
48 0.49
49 0.39
50 0.3
51 0.25
52 0.21
53 0.21
54 0.19
55 0.12
56 0.12
57 0.14
58 0.16
59 0.17
60 0.15
61 0.14
62 0.13
63 0.15
64 0.16
65 0.14
66 0.17
67 0.15
68 0.15
69 0.2
70 0.2
71 0.19
72 0.22
73 0.28
74 0.28
75 0.34
76 0.37
77 0.35
78 0.35
79 0.35
80 0.35
81 0.28
82 0.25
83 0.19
84 0.17
85 0.13
86 0.12
87 0.13
88 0.1
89 0.11
90 0.12
91 0.12
92 0.1
93 0.1
94 0.11
95 0.1
96 0.1
97 0.08
98 0.07
99 0.11
100 0.11
101 0.1
102 0.1
103 0.09
104 0.09
105 0.1
106 0.08
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.02
119 0.02
120 0.02
121 0.03
122 0.04
123 0.04
124 0.04
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.07
131 0.08
132 0.1
133 0.1
134 0.1
135 0.13
136 0.15
137 0.15
138 0.15
139 0.15
140 0.13
141 0.12
142 0.13
143 0.1
144 0.08
145 0.08
146 0.08
147 0.06
148 0.06
149 0.05
150 0.05
151 0.04
152 0.04
153 0.04
154 0.03
155 0.04
156 0.04
157 0.05
158 0.05
159 0.06
160 0.09
161 0.11
162 0.14
163 0.14
164 0.2
165 0.21
166 0.23
167 0.22
168 0.19
169 0.17
170 0.16
171 0.14
172 0.08
173 0.07
174 0.05
175 0.07
176 0.07
177 0.07
178 0.08
179 0.1
180 0.13
181 0.17
182 0.18
183 0.18
184 0.18
185 0.17
186 0.17
187 0.17
188 0.17
189 0.13
190 0.12
191 0.11
192 0.11
193 0.11
194 0.11
195 0.09
196 0.09
197 0.13
198 0.15
199 0.14
200 0.15
201 0.15
202 0.15
203 0.16
204 0.14
205 0.17
206 0.24
207 0.34
208 0.4
209 0.42
210 0.45
211 0.51
212 0.58
213 0.63
214 0.63
215 0.62
216 0.62
217 0.7
218 0.74
219 0.68
220 0.6
221 0.49
222 0.42
223 0.34
224 0.27
225 0.18
226 0.18
227 0.21
228 0.22
229 0.23
230 0.22
231 0.23
232 0.23
233 0.23
234 0.16
235 0.15
236 0.21
237 0.21