Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6P000

Protein Details
Accession A0A2R6P000    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MQKQPPQSPKSKQPRMAHRITAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MQKQPPQSPKSKQPRMAHRITAELKKHSTTNSLRDCALGNSTLALPLVDKAVGVGTALLLLVGTSPSADAAPPKRVLAMAQMLRIPLTTEGRSGVFSTSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.77
5 0.68
6 0.66
7 0.62
8 0.61
9 0.54
10 0.51
11 0.47
12 0.42
13 0.42
14 0.35
15 0.37
16 0.34
17 0.38
18 0.39
19 0.39
20 0.37
21 0.36
22 0.35
23 0.28
24 0.25
25 0.17
26 0.11
27 0.1
28 0.09
29 0.09
30 0.08
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.04
56 0.08
57 0.11
58 0.16
59 0.17
60 0.17
61 0.18
62 0.18
63 0.18
64 0.19
65 0.24
66 0.22
67 0.23
68 0.24
69 0.23
70 0.23
71 0.23
72 0.19
73 0.15
74 0.18
75 0.16
76 0.17
77 0.18
78 0.19
79 0.21
80 0.2