Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6S3T8

Protein Details
Accession A0A2R6S3T8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-89IYPKQLPRNRRSKSKNPSPVTKKGIHydrophilic
NLS Segment(s)
PositionSequence
75-75R
Subcellular Location(s) nucl 20.5, cyto_nucl 15, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSPSHQTDGARGIQRQLLVQSIDERGEDVWSGYMERYADPFNASPYLLHCSCPGATITPEISGDIYPKQLPRNRRSKSKNPSPVTKKGILEVTCRTKTKEKHDVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.26
4 0.22
5 0.18
6 0.18
7 0.18
8 0.17
9 0.17
10 0.15
11 0.15
12 0.12
13 0.11
14 0.1
15 0.08
16 0.07
17 0.07
18 0.08
19 0.07
20 0.08
21 0.08
22 0.08
23 0.1
24 0.1
25 0.1
26 0.12
27 0.12
28 0.12
29 0.13
30 0.12
31 0.11
32 0.11
33 0.16
34 0.14
35 0.15
36 0.13
37 0.14
38 0.14
39 0.14
40 0.13
41 0.09
42 0.09
43 0.1
44 0.1
45 0.09
46 0.09
47 0.08
48 0.09
49 0.08
50 0.09
51 0.08
52 0.09
53 0.1
54 0.12
55 0.19
56 0.23
57 0.31
58 0.39
59 0.49
60 0.53
61 0.62
62 0.69
63 0.72
64 0.79
65 0.81
66 0.83
67 0.79
68 0.84
69 0.81
70 0.82
71 0.78
72 0.74
73 0.64
74 0.57
75 0.58
76 0.49
77 0.46
78 0.45
79 0.47
80 0.47
81 0.48
82 0.49
83 0.51
84 0.56
85 0.61