Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NW12

Protein Details
Accession A0A2R6NW12    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-115GDSRNNRQGRKQNQAPKDKPRGSHydrophilic
NLS Segment(s)
PositionSequence
108-113PKDKPR
Subcellular Location(s) cyto 12.5, cyto_nucl 12.333, cyto_mito 9.498, nucl 6, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MGAAIPHLIQLATSLPGILPYAPEEIQTEVLTGTVEVQDEVIPEDEDEDISYRSRGKSTISVVIKIGDGVDEGARTGKGRNNWRNGVAPASGGDSRNNRQGRKQNQAPKDKPRGSEEKRTAEPERIVIREEDMENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.09
5 0.08
6 0.08
7 0.08
8 0.11
9 0.11
10 0.12
11 0.13
12 0.14
13 0.16
14 0.15
15 0.13
16 0.1
17 0.1
18 0.09
19 0.08
20 0.07
21 0.06
22 0.06
23 0.05
24 0.06
25 0.06
26 0.06
27 0.07
28 0.07
29 0.07
30 0.06
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.09
40 0.1
41 0.11
42 0.11
43 0.12
44 0.16
45 0.18
46 0.25
47 0.25
48 0.25
49 0.25
50 0.25
51 0.22
52 0.18
53 0.15
54 0.06
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.07
64 0.09
65 0.16
66 0.26
67 0.33
68 0.4
69 0.43
70 0.45
71 0.47
72 0.45
73 0.41
74 0.31
75 0.24
76 0.18
77 0.18
78 0.17
79 0.14
80 0.16
81 0.18
82 0.21
83 0.29
84 0.33
85 0.32
86 0.39
87 0.48
88 0.53
89 0.59
90 0.65
91 0.67
92 0.71
93 0.81
94 0.8
95 0.8
96 0.83
97 0.78
98 0.73
99 0.71
100 0.72
101 0.68
102 0.71
103 0.69
104 0.66
105 0.65
106 0.68
107 0.64
108 0.6
109 0.55
110 0.51
111 0.49
112 0.42
113 0.4
114 0.34
115 0.33
116 0.31