Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6Q7L5

Protein Details
Accession A0A2R6Q7L5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
31-53QSSERPRKRARIPKLKTPRNLKDBasic
NLS Segment(s)
PositionSequence
35-48RPRKRARIPKLKTP
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MAPAHRVLKTSGEPPVILGLKRPYQLDNTHQSSERPRKRARIPKLKTPRNLKDTILPYPGYQDDAVAFSPFLLDNPRRNSAIPPVVPLRDLPKIDLLKTKLINRKSSLGLRYIKVNQDPPKQDFVKQANELCIGYVVPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.29
4 0.25
5 0.26
6 0.26
7 0.28
8 0.3
9 0.31
10 0.27
11 0.29
12 0.34
13 0.37
14 0.4
15 0.41
16 0.42
17 0.41
18 0.42
19 0.47
20 0.53
21 0.55
22 0.54
23 0.54
24 0.6
25 0.69
26 0.77
27 0.78
28 0.78
29 0.76
30 0.79
31 0.84
32 0.84
33 0.82
34 0.82
35 0.8
36 0.75
37 0.72
38 0.62
39 0.59
40 0.54
41 0.5
42 0.42
43 0.34
44 0.27
45 0.27
46 0.26
47 0.2
48 0.15
49 0.12
50 0.09
51 0.1
52 0.1
53 0.08
54 0.07
55 0.05
56 0.06
57 0.05
58 0.05
59 0.08
60 0.1
61 0.15
62 0.2
63 0.23
64 0.23
65 0.24
66 0.25
67 0.28
68 0.32
69 0.27
70 0.26
71 0.26
72 0.25
73 0.25
74 0.24
75 0.22
76 0.2
77 0.2
78 0.18
79 0.23
80 0.24
81 0.25
82 0.31
83 0.29
84 0.3
85 0.34
86 0.4
87 0.4
88 0.44
89 0.48
90 0.45
91 0.47
92 0.46
93 0.49
94 0.44
95 0.43
96 0.43
97 0.38
98 0.41
99 0.41
100 0.42
101 0.4
102 0.46
103 0.47
104 0.52
105 0.58
106 0.56
107 0.6
108 0.56
109 0.56
110 0.56
111 0.54
112 0.53
113 0.52
114 0.51
115 0.46
116 0.47
117 0.43
118 0.34
119 0.3