Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NJ36

Protein Details
Accession A0A2R6NJ36    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
105-124TPETKQPSGVRHRNGKNKKRBasic
NLS Segment(s)
PositionSequence
115-124RHRNGKNKKR
Subcellular Location(s) mito 7extr 7, golg 5, E.R. 3, nucl 1, cyto 1, plas 1, cyto_nucl 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039163  EMC7  
IPR019008  EMC7_beta_sandwich  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF09430  EMC7_beta-sandw  
Amino Acid Sequences MTLPYPITLSAVQKIDFYMPRQAFNLIGMFKNPMMMMMLVGGALVFAMPYIMKNMDPEVLQDFEKRQAKITNIQSSLQSGDLKSGLSALMAVGDEDATAASGKQTPETKQPSGVRHRNGKNKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.24
5 0.29
6 0.28
7 0.29
8 0.3
9 0.3
10 0.26
11 0.25
12 0.25
13 0.17
14 0.17
15 0.15
16 0.16
17 0.15
18 0.15
19 0.13
20 0.1
21 0.09
22 0.09
23 0.08
24 0.06
25 0.06
26 0.05
27 0.05
28 0.04
29 0.03
30 0.02
31 0.02
32 0.02
33 0.01
34 0.02
35 0.02
36 0.02
37 0.04
38 0.05
39 0.05
40 0.06
41 0.07
42 0.08
43 0.08
44 0.09
45 0.1
46 0.1
47 0.11
48 0.11
49 0.11
50 0.17
51 0.21
52 0.2
53 0.21
54 0.22
55 0.24
56 0.32
57 0.38
58 0.38
59 0.36
60 0.36
61 0.34
62 0.33
63 0.31
64 0.25
65 0.19
66 0.12
67 0.11
68 0.11
69 0.1
70 0.09
71 0.08
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.03
85 0.04
86 0.04
87 0.05
88 0.08
89 0.08
90 0.13
91 0.17
92 0.19
93 0.29
94 0.36
95 0.37
96 0.42
97 0.48
98 0.52
99 0.6
100 0.66
101 0.65
102 0.68
103 0.76
104 0.79