Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2R6NEL2

Protein Details
Accession A0A2R6NEL2    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-27YEKPSQKKSSSTEKKERKKLALLHydrophilic
49-75FPPEVRFKSRQPRKRTLCGRKSGKLPEHydrophilic
NLS Segment(s)
PositionSequence
60-62PRK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MAEAYEKPSQKKSSSTEKKERKKLALLELRVDLNHIMHHPKQKRYISLFPPEVRFKSRQPRKRTLCGRKSGKLPEAIWRVRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.68
4 0.74
5 0.81
6 0.85
7 0.86
8 0.8
9 0.77
10 0.72
11 0.72
12 0.7
13 0.61
14 0.54
15 0.49
16 0.43
17 0.36
18 0.31
19 0.21
20 0.13
21 0.11
22 0.1
23 0.12
24 0.14
25 0.23
26 0.27
27 0.31
28 0.39
29 0.41
30 0.45
31 0.47
32 0.52
33 0.49
34 0.52
35 0.53
36 0.47
37 0.5
38 0.48
39 0.44
40 0.41
41 0.39
42 0.38
43 0.44
44 0.52
45 0.56
46 0.61
47 0.7
48 0.73
49 0.8
50 0.85
51 0.85
52 0.84
53 0.85
54 0.85
55 0.8
56 0.8
57 0.78
58 0.73
59 0.69
60 0.61
61 0.6
62 0.61