Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2R6S6A8

Protein Details
Accession A0A2R6S6A8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-64AAAARKPQPPRKKTEKRESLRSSSSHydrophilic
NLS Segment(s)
PositionSequence
43-56ARKPQPPRKKTEKR
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 7
Family & Domain DBs
Amino Acid Sequences MTSDVSGSFGGRSSPVTSSSIIPTENEFYVSVELYLSRAAAAARKPQPPRKKTEKRESLRSSSSTNDLNQKKVKGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.17
5 0.18
6 0.19
7 0.19
8 0.17
9 0.16
10 0.16
11 0.17
12 0.15
13 0.15
14 0.13
15 0.12
16 0.12
17 0.12
18 0.1
19 0.07
20 0.07
21 0.06
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.07
28 0.08
29 0.15
30 0.2
31 0.27
32 0.33
33 0.42
34 0.52
35 0.55
36 0.62
37 0.66
38 0.72
39 0.76
40 0.81
41 0.83
42 0.8
43 0.86
44 0.85
45 0.81
46 0.75
47 0.68
48 0.6
49 0.52
50 0.49
51 0.41
52 0.38
53 0.4
54 0.38
55 0.43
56 0.46