Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LRT2

Protein Details
Accession A0A1U7LRT2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-106TSDKTNCRTRWTLRRPRNSRKWTKRFRPHydrophilic
NLS Segment(s)
PositionSequence
92-106RRPRNSRKWTKRFRP
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010776  Hop2_WH_dom  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0090304  P:nucleic acid metabolic process  
Pfam View protein in Pfam  
PF07106  TBPIP  
Amino Acid Sequences MGKVKTTQVKGDEAEKIVLEYLRKQNRPYSATDISCNLHNSVTKASAAKVLALLEKQGEIAVKTYGKQSVYVIKQDSNTSDKTNCRTRWTLRRPRNSRKWTKRFRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.26
3 0.23
4 0.2
5 0.19
6 0.16
7 0.19
8 0.26
9 0.34
10 0.36
11 0.39
12 0.43
13 0.49
14 0.5
15 0.49
16 0.47
17 0.45
18 0.44
19 0.43
20 0.4
21 0.34
22 0.33
23 0.3
24 0.23
25 0.17
26 0.17
27 0.17
28 0.16
29 0.16
30 0.14
31 0.13
32 0.13
33 0.14
34 0.13
35 0.12
36 0.11
37 0.1
38 0.09
39 0.09
40 0.09
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.07
50 0.08
51 0.1
52 0.12
53 0.12
54 0.13
55 0.13
56 0.2
57 0.22
58 0.25
59 0.26
60 0.25
61 0.26
62 0.27
63 0.29
64 0.25
65 0.24
66 0.24
67 0.26
68 0.29
69 0.33
70 0.41
71 0.41
72 0.44
73 0.49
74 0.54
75 0.61
76 0.68
77 0.73
78 0.74
79 0.82
80 0.85
81 0.9
82 0.92
83 0.92
84 0.93
85 0.93
86 0.94