Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1U7LMQ5

Protein Details
Accession A0A1U7LMQ5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
124-150ADRSAQQPRARRTRKRRRAVDHERVDABasic
167-196ARAEAAHRARQHRRPRIQRARRSQGKEGVPBasic
NLS Segment(s)
PositionSequence
118-192KRPQPRADRSAQQPRARRTRKRRRAVDHERVDAPHRLRRVDVVRRKVVHARAEAAHRARQHRRPRIQRARRSQGK
Subcellular Location(s) nucl 7, cyto 7, cyto_nucl 7, extr 5
Family & Domain DBs
Amino Acid Sequences MRLFNGGSGRDPEGMGRGQGRDQKRPGSDRDQDQKRSGQIRQIVYTGRLQKLFSLAVVLSLVAQPLSVGGDAGDLLAVVVGHRVCVALEARVDAAGADAAQEQRLAGGELGQAAPVHKRPQPRADRSAQQPRARRTRKRRRAVDHERVDAPHRLRRVDVVRRKVVHARAEAAHRARQHRRPRIQRARRSQGKEGVPVGDGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.18
5 0.22
6 0.3
7 0.35
8 0.4
9 0.44
10 0.49
11 0.53
12 0.57
13 0.58
14 0.6
15 0.62
16 0.63
17 0.69
18 0.7
19 0.68
20 0.67
21 0.66
22 0.63
23 0.61
24 0.54
25 0.51
26 0.49
27 0.48
28 0.46
29 0.43
30 0.38
31 0.34
32 0.39
33 0.37
34 0.34
35 0.31
36 0.29
37 0.27
38 0.28
39 0.26
40 0.19
41 0.15
42 0.11
43 0.1
44 0.1
45 0.09
46 0.07
47 0.06
48 0.06
49 0.04
50 0.04
51 0.03
52 0.03
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.03
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.05
81 0.05
82 0.03
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.07
102 0.08
103 0.11
104 0.13
105 0.2
106 0.24
107 0.34
108 0.43
109 0.49
110 0.53
111 0.56
112 0.6
113 0.63
114 0.69
115 0.68
116 0.65
117 0.65
118 0.66
119 0.71
120 0.73
121 0.75
122 0.76
123 0.79
124 0.83
125 0.87
126 0.89
127 0.88
128 0.9
129 0.91
130 0.9
131 0.86
132 0.8
133 0.72
134 0.64
135 0.58
136 0.53
137 0.46
138 0.4
139 0.35
140 0.32
141 0.3
142 0.35
143 0.41
144 0.45
145 0.5
146 0.54
147 0.59
148 0.6
149 0.64
150 0.64
151 0.62
152 0.58
153 0.51
154 0.47
155 0.42
156 0.45
157 0.48
158 0.45
159 0.43
160 0.42
161 0.47
162 0.52
163 0.58
164 0.64
165 0.68
166 0.75
167 0.81
168 0.87
169 0.9
170 0.92
171 0.93
172 0.93
173 0.93
174 0.93
175 0.9
176 0.87
177 0.84
178 0.79
179 0.74
180 0.66
181 0.57
182 0.47