Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1U7LSA1

Protein Details
Accession A0A1U7LSA1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-46LLRFASSRAKRPPQTKKIVTNKNIGNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR000235  Ribosomal_S5/S7  
IPR023798  Ribosomal_S7_dom  
IPR036823  Ribosomal_S7_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00177  Ribosomal_S7  
CDD cd14868  uS7_Mitochondria_Fungi  
Amino Acid Sequences MFVLSPLRPLLGRFPVQNRLLLRFASSRAKRPPQTKKIVTNKNIGNVTEKATASDNILHNDKECPEKPSPIVQEDSIAVQKIFEQATASDNILHSDKEDPENPSPIDQVPEDSIAVQKISEQGNTALEDTPEAIMGLEGPDGLKRIQFDLQGNPDPEELCVDPKSINIPVRTDPLCAYFVNLIMREGKKSKAQKLVQDILEYLRGKVHVDPVETLRQAVESASPLVKIVQQSKGSKKVAVPVPLKERQRHRQALLWMCGACDKRGHTNFSIRFAQEVLEVMEGKSSVFQKKEQVHRMAMINRSNAVIKADS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.46
4 0.5
5 0.46
6 0.44
7 0.43
8 0.37
9 0.36
10 0.3
11 0.32
12 0.38
13 0.39
14 0.42
15 0.49
16 0.59
17 0.63
18 0.7
19 0.77
20 0.77
21 0.83
22 0.83
23 0.84
24 0.85
25 0.88
26 0.83
27 0.81
28 0.75
29 0.72
30 0.66
31 0.56
32 0.51
33 0.42
34 0.41
35 0.37
36 0.33
37 0.27
38 0.26
39 0.26
40 0.23
41 0.27
42 0.25
43 0.24
44 0.26
45 0.25
46 0.24
47 0.26
48 0.25
49 0.27
50 0.26
51 0.28
52 0.29
53 0.33
54 0.35
55 0.4
56 0.43
57 0.38
58 0.39
59 0.33
60 0.32
61 0.28
62 0.28
63 0.21
64 0.18
65 0.14
66 0.12
67 0.12
68 0.13
69 0.12
70 0.1
71 0.1
72 0.09
73 0.12
74 0.14
75 0.13
76 0.12
77 0.11
78 0.13
79 0.13
80 0.12
81 0.11
82 0.13
83 0.14
84 0.16
85 0.19
86 0.22
87 0.24
88 0.28
89 0.27
90 0.25
91 0.25
92 0.22
93 0.21
94 0.16
95 0.15
96 0.12
97 0.13
98 0.12
99 0.11
100 0.11
101 0.09
102 0.09
103 0.07
104 0.07
105 0.09
106 0.1
107 0.1
108 0.1
109 0.11
110 0.12
111 0.13
112 0.14
113 0.11
114 0.1
115 0.1
116 0.09
117 0.08
118 0.06
119 0.06
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.04
129 0.05
130 0.06
131 0.06
132 0.08
133 0.1
134 0.12
135 0.14
136 0.17
137 0.21
138 0.23
139 0.24
140 0.23
141 0.21
142 0.19
143 0.17
144 0.15
145 0.11
146 0.1
147 0.1
148 0.09
149 0.09
150 0.09
151 0.11
152 0.13
153 0.16
154 0.15
155 0.17
156 0.18
157 0.22
158 0.22
159 0.21
160 0.18
161 0.18
162 0.18
163 0.16
164 0.16
165 0.12
166 0.13
167 0.14
168 0.13
169 0.11
170 0.14
171 0.14
172 0.16
173 0.17
174 0.18
175 0.24
176 0.3
177 0.36
178 0.42
179 0.45
180 0.48
181 0.54
182 0.58
183 0.52
184 0.47
185 0.41
186 0.32
187 0.34
188 0.28
189 0.21
190 0.16
191 0.15
192 0.15
193 0.15
194 0.21
195 0.17
196 0.18
197 0.2
198 0.22
199 0.27
200 0.26
201 0.25
202 0.18
203 0.16
204 0.15
205 0.13
206 0.11
207 0.07
208 0.09
209 0.09
210 0.09
211 0.09
212 0.1
213 0.12
214 0.14
215 0.16
216 0.21
217 0.27
218 0.33
219 0.39
220 0.47
221 0.47
222 0.46
223 0.44
224 0.46
225 0.46
226 0.48
227 0.45
228 0.43
229 0.49
230 0.54
231 0.58
232 0.57
233 0.6
234 0.62
235 0.69
236 0.7
237 0.65
238 0.65
239 0.68
240 0.69
241 0.64
242 0.58
243 0.48
244 0.4
245 0.42
246 0.37
247 0.29
248 0.24
249 0.23
250 0.29
251 0.34
252 0.39
253 0.38
254 0.47
255 0.49
256 0.52
257 0.54
258 0.44
259 0.41
260 0.36
261 0.32
262 0.23
263 0.21
264 0.17
265 0.13
266 0.13
267 0.12
268 0.13
269 0.12
270 0.11
271 0.14
272 0.16
273 0.2
274 0.22
275 0.25
276 0.32
277 0.41
278 0.52
279 0.57
280 0.59
281 0.57
282 0.59
283 0.64
284 0.61
285 0.59
286 0.55
287 0.48
288 0.43
289 0.42
290 0.39
291 0.33