Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LS59

Protein Details
Accession A0A1U7LS59   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-31KGLGKGFPQKRHRKIVKDAIFBasic
NLS Segment(s)
PositionSequence
10-49GKGLGKGFPQKRHRKIVKDAIFGISKPDIRRMARRGGVKR
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035425  CENP-T/H4_C  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
IPR004823  TAF_TATA-bd_Histone-like_dom  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF15511  CENP-T_C  
Amino Acid Sequences MPPPQRSSGGKGLGKGFPQKRHRKIVKDAIFGISKPDIRRMARRGGVKRISAGIYNEARKAMRQFLKEVLHDCTIFVDHSSRKTITVRDVIYALKRRGRPIYGFDPDVTKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.47
4 0.48
5 0.56
6 0.64
7 0.67
8 0.75
9 0.8
10 0.78
11 0.81
12 0.82
13 0.8
14 0.74
15 0.68
16 0.61
17 0.54
18 0.46
19 0.39
20 0.31
21 0.26
22 0.22
23 0.26
24 0.27
25 0.29
26 0.36
27 0.37
28 0.41
29 0.44
30 0.51
31 0.5
32 0.53
33 0.54
34 0.48
35 0.45
36 0.39
37 0.35
38 0.28
39 0.25
40 0.21
41 0.19
42 0.2
43 0.19
44 0.18
45 0.17
46 0.17
47 0.18
48 0.2
49 0.22
50 0.22
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.29
57 0.26
58 0.25
59 0.22
60 0.17
61 0.15
62 0.14
63 0.12
64 0.13
65 0.12
66 0.15
67 0.18
68 0.18
69 0.2
70 0.22
71 0.24
72 0.26
73 0.31
74 0.29
75 0.27
76 0.28
77 0.28
78 0.33
79 0.38
80 0.37
81 0.38
82 0.4
83 0.44
84 0.48
85 0.51
86 0.48
87 0.48
88 0.53
89 0.52
90 0.52
91 0.47
92 0.45