Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LQH5

Protein Details
Accession A0A1U7LQH5   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-65LSLKRHRQVGPRSRCRNRRLRRPLQTCLSHydrophilic
NLS Segment(s)
PositionSequence
30-58PRRKVGSLSLKRHRQVGPRSRCRNRRLRR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR007512  Mic10  
Gene Ontology GO:0061617  C:MICOS complex  
Pfam View protein in Pfam  
PF04418  DUF543  
Amino Acid Sequences MCTALHNSCPQDDSAPRSGSRSPTTLGGSPRRKVGSLSLKRHRQVGPRSRCRNRRLRRPLQTCLSPSSRSPPLTRPGRTWPAWIGLGFGLGQSYADCDRHFNPLLLPGTRIIRPNTPNSASAPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.32
4 0.34
5 0.37
6 0.37
7 0.38
8 0.34
9 0.28
10 0.29
11 0.32
12 0.33
13 0.36
14 0.4
15 0.43
16 0.42
17 0.46
18 0.44
19 0.41
20 0.38
21 0.41
22 0.42
23 0.45
24 0.53
25 0.57
26 0.63
27 0.63
28 0.67
29 0.62
30 0.6
31 0.6
32 0.61
33 0.63
34 0.66
35 0.75
36 0.79
37 0.83
38 0.83
39 0.83
40 0.82
41 0.82
42 0.82
43 0.83
44 0.85
45 0.83
46 0.81
47 0.75
48 0.7
49 0.61
50 0.54
51 0.47
52 0.38
53 0.32
54 0.31
55 0.3
56 0.28
57 0.28
58 0.28
59 0.33
60 0.39
61 0.41
62 0.39
63 0.43
64 0.47
65 0.46
66 0.44
67 0.37
68 0.33
69 0.32
70 0.28
71 0.22
72 0.15
73 0.15
74 0.12
75 0.1
76 0.06
77 0.05
78 0.05
79 0.04
80 0.06
81 0.07
82 0.09
83 0.09
84 0.13
85 0.15
86 0.21
87 0.22
88 0.21
89 0.2
90 0.26
91 0.3
92 0.27
93 0.27
94 0.24
95 0.26
96 0.28
97 0.31
98 0.27
99 0.31
100 0.34
101 0.4
102 0.45
103 0.44
104 0.44
105 0.44