Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LLD5

Protein Details
Accession A0A1U7LLD5    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
4-29TIPGIRKSGKQWKPPSKPSRRTQISAHydrophilic
85-111LLEAKMHKKKVERMRKKEKRNKMLKERBasic
NLS Segment(s)
PositionSequence
10-23KSGKQWKPPSKPSR
62-111EKERRVGIIKERRAQAAEKERFALLEAKMHKKKVERMRKKEKRNKMLKER
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MTTTIPGIRKSGKQWKPPSKPSRRTQISASLKTSWSQRSALREKLAQIKSHELRLHTEKLAEKERRVGIIKERRAQAAEKERFALLEAKMHKKKVERMRKKEKRNKMLKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.74
3 0.79
4 0.86
5 0.88
6 0.89
7 0.9
8 0.87
9 0.88
10 0.83
11 0.77
12 0.7
13 0.7
14 0.68
15 0.64
16 0.6
17 0.51
18 0.45
19 0.43
20 0.43
21 0.35
22 0.28
23 0.26
24 0.25
25 0.31
26 0.36
27 0.39
28 0.37
29 0.36
30 0.36
31 0.43
32 0.42
33 0.36
34 0.33
35 0.37
36 0.36
37 0.39
38 0.38
39 0.29
40 0.31
41 0.32
42 0.33
43 0.25
44 0.26
45 0.23
46 0.25
47 0.33
48 0.31
49 0.28
50 0.31
51 0.32
52 0.33
53 0.33
54 0.31
55 0.32
56 0.39
57 0.45
58 0.45
59 0.45
60 0.43
61 0.43
62 0.42
63 0.41
64 0.43
65 0.41
66 0.37
67 0.37
68 0.35
69 0.33
70 0.33
71 0.29
72 0.18
73 0.2
74 0.24
75 0.33
76 0.37
77 0.39
78 0.42
79 0.44
80 0.53
81 0.57
82 0.64
83 0.65
84 0.71
85 0.81
86 0.87
87 0.92
88 0.94
89 0.94
90 0.93
91 0.93