Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1U7LVA1

Protein Details
Accession A0A1U7LVA1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
135-156WFSRRERDKKRGLWDRVPKERPBasic
NLS Segment(s)
PositionSequence
122-127KRRESR
137-190SRRERDKKRGLWDRVPKERPPVPRESPREGLFGGFRRGRNSSRDERPGSSRFRA
Subcellular Location(s) nucl 19, cyto_nucl 11.833, mito_nucl 11.833, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
Amino Acid Sequences CSTCGAVDSHPTTRCPTVIKCRNCGKLGHLQNVRRKCNSTNHNADACPLIWRVYIPVDKPPRDFKLPIFCYNCASSTHYGDNCPFPSRHRRDGVSAFNLANAPISREEESRLEKADRIAVAKRRESRRGEEQDDWFSRRERDKKRGLWDRVPKERPPVPRESPREGLFGGFRRGRNSSRDERPGSSRFRASGHNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.36
4 0.41
5 0.49
6 0.53
7 0.57
8 0.64
9 0.69
10 0.66
11 0.61
12 0.55
13 0.56
14 0.57
15 0.58
16 0.57
17 0.58
18 0.64
19 0.71
20 0.72
21 0.66
22 0.62
23 0.58
24 0.6
25 0.6
26 0.61
27 0.61
28 0.61
29 0.6
30 0.56
31 0.52
32 0.44
33 0.37
34 0.29
35 0.21
36 0.15
37 0.12
38 0.12
39 0.12
40 0.15
41 0.17
42 0.16
43 0.24
44 0.32
45 0.34
46 0.37
47 0.42
48 0.42
49 0.45
50 0.45
51 0.41
52 0.44
53 0.46
54 0.5
55 0.48
56 0.43
57 0.41
58 0.41
59 0.38
60 0.29
61 0.28
62 0.22
63 0.21
64 0.24
65 0.22
66 0.22
67 0.22
68 0.24
69 0.21
70 0.22
71 0.19
72 0.19
73 0.3
74 0.34
75 0.4
76 0.4
77 0.41
78 0.43
79 0.48
80 0.48
81 0.4
82 0.36
83 0.29
84 0.26
85 0.24
86 0.19
87 0.15
88 0.1
89 0.09
90 0.07
91 0.1
92 0.1
93 0.11
94 0.13
95 0.15
96 0.18
97 0.18
98 0.19
99 0.18
100 0.18
101 0.18
102 0.19
103 0.17
104 0.16
105 0.2
106 0.25
107 0.29
108 0.34
109 0.4
110 0.43
111 0.5
112 0.52
113 0.54
114 0.57
115 0.6
116 0.6
117 0.58
118 0.56
119 0.56
120 0.55
121 0.51
122 0.42
123 0.36
124 0.35
125 0.39
126 0.45
127 0.45
128 0.52
129 0.59
130 0.65
131 0.73
132 0.79
133 0.78
134 0.78
135 0.8
136 0.8
137 0.81
138 0.79
139 0.72
140 0.7
141 0.68
142 0.67
143 0.63
144 0.62
145 0.6
146 0.64
147 0.68
148 0.68
149 0.68
150 0.61
151 0.58
152 0.5
153 0.44
154 0.39
155 0.35
156 0.35
157 0.34
158 0.34
159 0.35
160 0.4
161 0.41
162 0.42
163 0.46
164 0.48
165 0.53
166 0.6
167 0.61
168 0.61
169 0.64
170 0.65
171 0.64
172 0.61
173 0.56
174 0.49
175 0.47