Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LHM3

Protein Details
Accession A0A1U7LHM3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-32ATRKAAPTTKSKKDPNHPKRALSHydrophilic
NLS Segment(s)
PositionSequence
7-28KPRATRKAAPTTKSKKDPNHPK
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF00505  HMG_box  
Amino Acid Sequences MPKAATKPRATRKAAPTTKSKKDPNHPKRALSAYMFFANEERPKVIQESPETSFGMCNFLFLQCPTLPHTRLPIDSHAAHILFPPASLRVSCPLLTVPGQIGKILGPFDKKAAEDKKRYETQKAAYIAKPASAGEEEEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.74
3 0.74
4 0.73
5 0.76
6 0.76
7 0.75
8 0.73
9 0.77
10 0.84
11 0.84
12 0.86
13 0.82
14 0.76
15 0.74
16 0.7
17 0.63
18 0.55
19 0.48
20 0.39
21 0.37
22 0.33
23 0.27
24 0.23
25 0.22
26 0.21
27 0.2
28 0.18
29 0.16
30 0.17
31 0.2
32 0.21
33 0.21
34 0.22
35 0.25
36 0.26
37 0.27
38 0.26
39 0.23
40 0.22
41 0.18
42 0.18
43 0.13
44 0.12
45 0.1
46 0.1
47 0.11
48 0.1
49 0.13
50 0.09
51 0.11
52 0.14
53 0.17
54 0.18
55 0.18
56 0.22
57 0.2
58 0.21
59 0.22
60 0.2
61 0.2
62 0.19
63 0.2
64 0.18
65 0.17
66 0.15
67 0.13
68 0.12
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.08
76 0.1
77 0.13
78 0.13
79 0.13
80 0.12
81 0.14
82 0.14
83 0.14
84 0.12
85 0.13
86 0.13
87 0.12
88 0.12
89 0.1
90 0.11
91 0.11
92 0.12
93 0.12
94 0.12
95 0.14
96 0.16
97 0.16
98 0.23
99 0.32
100 0.39
101 0.44
102 0.49
103 0.56
104 0.62
105 0.65
106 0.64
107 0.61
108 0.58
109 0.59
110 0.58
111 0.54
112 0.48
113 0.49
114 0.43
115 0.37
116 0.33
117 0.25
118 0.23
119 0.19
120 0.19
121 0.15
122 0.17