Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1U7LTR9

Protein Details
Accession A0A1U7LTR9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
190-212LDPEMKAKRRWGQIKKTPRIAMHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, cyto_nucl 8, nucl 6.5, mito 5, plas 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019154  Arb2_domain  
Pfam View protein in Pfam  
PF09757  Arb2  
Amino Acid Sequences MTEAWNMMKLPIARDYVSESFKDEAVCSPGFYNAETLVLFIHDAPEVYAQTDPLSNKVELHKSFLLDHANTCIEWIMSQNYGLIDVNVPAMLTGVDDPDYTIESATKELCLYTWDNYIELADAKNVIFFGVGKACAGLINLIGARDVTKRVKASLNFIGQDPIKGIQGDDDLKMWYSKHAISYIASNHPLDPEMKAKRRWGQIKKTPRIAMHEILITGFDDAKYFIEKQICEDPQASGNPELKRKAPEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.31
4 0.32
5 0.3
6 0.28
7 0.26
8 0.27
9 0.26
10 0.2
11 0.18
12 0.2
13 0.2
14 0.18
15 0.17
16 0.19
17 0.19
18 0.18
19 0.17
20 0.13
21 0.14
22 0.13
23 0.12
24 0.09
25 0.09
26 0.09
27 0.07
28 0.07
29 0.06
30 0.06
31 0.07
32 0.09
33 0.09
34 0.1
35 0.1
36 0.09
37 0.1
38 0.13
39 0.13
40 0.14
41 0.17
42 0.16
43 0.19
44 0.23
45 0.3
46 0.27
47 0.33
48 0.31
49 0.29
50 0.3
51 0.3
52 0.3
53 0.24
54 0.23
55 0.2
56 0.19
57 0.18
58 0.17
59 0.14
60 0.09
61 0.09
62 0.1
63 0.09
64 0.08
65 0.09
66 0.09
67 0.09
68 0.1
69 0.1
70 0.08
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.06
97 0.08
98 0.09
99 0.09
100 0.12
101 0.12
102 0.12
103 0.12
104 0.12
105 0.1
106 0.09
107 0.07
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.03
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.06
133 0.09
134 0.11
135 0.14
136 0.15
137 0.17
138 0.23
139 0.23
140 0.28
141 0.31
142 0.33
143 0.3
144 0.3
145 0.31
146 0.25
147 0.25
148 0.2
149 0.14
150 0.12
151 0.11
152 0.1
153 0.09
154 0.11
155 0.12
156 0.11
157 0.11
158 0.11
159 0.11
160 0.12
161 0.11
162 0.1
163 0.11
164 0.12
165 0.13
166 0.14
167 0.14
168 0.14
169 0.18
170 0.2
171 0.22
172 0.23
173 0.21
174 0.21
175 0.2
176 0.21
177 0.18
178 0.16
179 0.21
180 0.27
181 0.33
182 0.37
183 0.43
184 0.49
185 0.58
186 0.66
187 0.68
188 0.7
189 0.74
190 0.81
191 0.83
192 0.84
193 0.81
194 0.74
195 0.72
196 0.66
197 0.59
198 0.51
199 0.43
200 0.35
201 0.29
202 0.26
203 0.19
204 0.14
205 0.11
206 0.08
207 0.07
208 0.08
209 0.09
210 0.12
211 0.13
212 0.16
213 0.21
214 0.21
215 0.26
216 0.34
217 0.35
218 0.34
219 0.34
220 0.32
221 0.31
222 0.34
223 0.33
224 0.29
225 0.34
226 0.36
227 0.41
228 0.43
229 0.42