Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LGX8

Protein Details
Accession A0A1U7LGX8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
77-99VADLQHPKKKRFPALRKLFRLPLHydrophilic
NLS Segment(s)
PositionSequence
84-92KKKRFPALR
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MRMSMRQPASSRSPSRSRSPPISAPLPLPLSSPSARTPSANRRSMPSTMRRRPQSISSIQHNAPPPLSSRARKTQSVADLQHPKKKRFPALRKLFRLPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.63
4 0.63
5 0.61
6 0.62
7 0.61
8 0.58
9 0.57
10 0.51
11 0.44
12 0.41
13 0.36
14 0.3
15 0.25
16 0.2
17 0.21
18 0.2
19 0.21
20 0.18
21 0.2
22 0.2
23 0.21
24 0.25
25 0.32
26 0.4
27 0.42
28 0.41
29 0.41
30 0.44
31 0.46
32 0.45
33 0.44
34 0.46
35 0.48
36 0.55
37 0.54
38 0.54
39 0.53
40 0.52
41 0.49
42 0.46
43 0.44
44 0.42
45 0.43
46 0.41
47 0.43
48 0.4
49 0.35
50 0.28
51 0.24
52 0.22
53 0.23
54 0.29
55 0.28
56 0.32
57 0.4
58 0.45
59 0.47
60 0.47
61 0.47
62 0.47
63 0.51
64 0.48
65 0.47
66 0.53
67 0.55
68 0.6
69 0.6
70 0.59
71 0.6
72 0.65
73 0.67
74 0.68
75 0.74
76 0.76
77 0.81
78 0.87
79 0.87