Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YTQ4

Protein Details
Accession G8YTQ4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-25SDDDSKISKRRQTKKACLSEEQKKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
Amino Acid Sequences MSDDDSKISKRRQTKKACLSEEQKKAHHIASEQKRRENIRSTFDKIVALTPSLNEHENRSELNILTKSADYIEALKQENDRLVALCRGRDIEVPSKLKYNGPGPEKMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.86
4 0.84
5 0.82
6 0.8
7 0.8
8 0.78
9 0.72
10 0.64
11 0.57
12 0.54
13 0.47
14 0.41
15 0.34
16 0.36
17 0.41
18 0.49
19 0.5
20 0.52
21 0.55
22 0.57
23 0.59
24 0.58
25 0.52
26 0.49
27 0.51
28 0.51
29 0.48
30 0.45
31 0.4
32 0.32
33 0.29
34 0.22
35 0.17
36 0.11
37 0.09
38 0.1
39 0.11
40 0.11
41 0.1
42 0.11
43 0.12
44 0.13
45 0.13
46 0.12
47 0.12
48 0.11
49 0.15
50 0.14
51 0.13
52 0.13
53 0.13
54 0.12
55 0.11
56 0.11
57 0.08
58 0.09
59 0.1
60 0.12
61 0.14
62 0.15
63 0.15
64 0.16
65 0.17
66 0.16
67 0.15
68 0.13
69 0.14
70 0.19
71 0.19
72 0.19
73 0.19
74 0.19
75 0.2
76 0.23
77 0.26
78 0.28
79 0.35
80 0.38
81 0.38
82 0.42
83 0.42
84 0.42
85 0.41
86 0.4
87 0.41
88 0.42