Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1U7LQT6

Protein Details
Accession A0A1U7LQT6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
65-92IYRYVERKVCKKRKEVKRKASNSSCTSTHydrophilic
NLS Segment(s)
PositionSequence
75-83KKRKEVKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MSIALCDLNASLLADFNHYGWNLAQERRNGNLTAPFVLITPSMHNMPSPVQALKDATLDIAVYFIYRYVERKVCKKRKEVKRKASNSSCTSTLSSSSKQTLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.13
5 0.12
6 0.13
7 0.12
8 0.18
9 0.19
10 0.22
11 0.26
12 0.28
13 0.31
14 0.33
15 0.35
16 0.3
17 0.28
18 0.29
19 0.26
20 0.23
21 0.2
22 0.17
23 0.15
24 0.15
25 0.13
26 0.09
27 0.09
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.1
34 0.12
35 0.12
36 0.1
37 0.1
38 0.11
39 0.12
40 0.11
41 0.11
42 0.08
43 0.07
44 0.06
45 0.06
46 0.05
47 0.05
48 0.04
49 0.03
50 0.03
51 0.04
52 0.05
53 0.06
54 0.08
55 0.13
56 0.19
57 0.23
58 0.33
59 0.44
60 0.52
61 0.59
62 0.68
63 0.73
64 0.79
65 0.87
66 0.89
67 0.89
68 0.9
69 0.91
70 0.91
71 0.89
72 0.87
73 0.81
74 0.75
75 0.65
76 0.57
77 0.51
78 0.42
79 0.38
80 0.34
81 0.31
82 0.31