Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LQP5

Protein Details
Accession A0A1U7LQP5   
Localization Confidence High
Confidence Score 22.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-35EEQKGQKVKNSRAKKLQIAEHydrophilic
264-294ALDTASKKEEKKRPKVSRKKRDEKFGFGGKKBasic
NLS Segment(s)
PositionSequence
212-250RKQRDLKKFGKQVQMAKLQEREKSKKDTLDKIKTLKRKR
270-300KKEEKKRPKVSRKKRDEKFGFGGKKRYSKSN
313-339VKKMKGTGPKKAGGVKKRLGKSRRAKN
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008610  Ebp2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF05890  Ebp2  
Amino Acid Sequences MVKVGVLKSALKRHIEEQKGQKVKNSRAKKLQIAENSTNQDRDNAEAPQLVHVEAEKDFEDNSSENDEEVESEGEEMALSDADSLILNANDDVDIVPYQRMTINNRSALAQKYKSICRPYSSLKFSDHQVVISSEAVNIKDVNDDLSRELAFYKQALEAAQNGKKLFVNEGVPFTRPTDYFAEMLKTDQHMDKVKNKLVEDATAKKASETARKQRDLKKFGKQVQMAKLQEREKSKKDTLDKIKTLKRKRGGEDLTTNDDFDVALDTASKKEEKKRPKVSRKKRDEKFGFGGKKRYSKSNDAKSSGDIDGFSVKKMKGTGPKKAGGVKKRLGKSRRAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.59
4 0.61
5 0.66
6 0.7
7 0.68
8 0.67
9 0.67
10 0.71
11 0.72
12 0.72
13 0.71
14 0.73
15 0.8
16 0.81
17 0.79
18 0.77
19 0.76
20 0.75
21 0.71
22 0.68
23 0.66
24 0.6
25 0.55
26 0.46
27 0.41
28 0.34
29 0.32
30 0.27
31 0.22
32 0.22
33 0.22
34 0.22
35 0.23
36 0.22
37 0.19
38 0.16
39 0.15
40 0.15
41 0.12
42 0.14
43 0.11
44 0.11
45 0.11
46 0.11
47 0.13
48 0.12
49 0.13
50 0.16
51 0.15
52 0.15
53 0.15
54 0.15
55 0.13
56 0.14
57 0.12
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.06
75 0.05
76 0.06
77 0.05
78 0.06
79 0.05
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.08
86 0.1
87 0.13
88 0.17
89 0.25
90 0.29
91 0.31
92 0.32
93 0.33
94 0.34
95 0.36
96 0.36
97 0.3
98 0.29
99 0.32
100 0.36
101 0.41
102 0.45
103 0.42
104 0.39
105 0.42
106 0.45
107 0.49
108 0.48
109 0.45
110 0.41
111 0.41
112 0.39
113 0.41
114 0.34
115 0.26
116 0.23
117 0.21
118 0.19
119 0.18
120 0.16
121 0.1
122 0.11
123 0.11
124 0.1
125 0.09
126 0.08
127 0.08
128 0.08
129 0.09
130 0.09
131 0.09
132 0.09
133 0.1
134 0.1
135 0.09
136 0.1
137 0.08
138 0.08
139 0.07
140 0.08
141 0.07
142 0.08
143 0.08
144 0.08
145 0.1
146 0.14
147 0.17
148 0.17
149 0.17
150 0.18
151 0.18
152 0.18
153 0.17
154 0.14
155 0.15
156 0.13
157 0.17
158 0.16
159 0.16
160 0.17
161 0.17
162 0.16
163 0.13
164 0.16
165 0.16
166 0.17
167 0.17
168 0.17
169 0.17
170 0.15
171 0.16
172 0.14
173 0.11
174 0.11
175 0.11
176 0.14
177 0.17
178 0.2
179 0.26
180 0.31
181 0.33
182 0.36
183 0.35
184 0.36
185 0.32
186 0.33
187 0.31
188 0.29
189 0.3
190 0.28
191 0.28
192 0.23
193 0.26
194 0.25
195 0.3
196 0.33
197 0.39
198 0.46
199 0.52
200 0.59
201 0.64
202 0.71
203 0.7
204 0.69
205 0.68
206 0.68
207 0.7
208 0.72
209 0.68
210 0.65
211 0.64
212 0.66
213 0.59
214 0.54
215 0.53
216 0.48
217 0.48
218 0.5
219 0.49
220 0.45
221 0.51
222 0.51
223 0.52
224 0.56
225 0.61
226 0.63
227 0.66
228 0.67
229 0.67
230 0.7
231 0.72
232 0.75
233 0.74
234 0.73
235 0.71
236 0.7
237 0.72
238 0.69
239 0.67
240 0.66
241 0.62
242 0.6
243 0.52
244 0.48
245 0.37
246 0.32
247 0.24
248 0.17
249 0.14
250 0.07
251 0.07
252 0.08
253 0.09
254 0.1
255 0.12
256 0.15
257 0.16
258 0.26
259 0.35
260 0.45
261 0.55
262 0.66
263 0.75
264 0.83
265 0.91
266 0.93
267 0.95
268 0.95
269 0.95
270 0.92
271 0.92
272 0.88
273 0.85
274 0.81
275 0.8
276 0.79
277 0.73
278 0.74
279 0.7
280 0.71
281 0.66
282 0.67
283 0.64
284 0.65
285 0.7
286 0.72
287 0.74
288 0.7
289 0.68
290 0.62
291 0.59
292 0.5
293 0.4
294 0.29
295 0.22
296 0.24
297 0.23
298 0.22
299 0.22
300 0.21
301 0.23
302 0.25
303 0.3
304 0.34
305 0.41
306 0.5
307 0.52
308 0.57
309 0.59
310 0.65
311 0.68
312 0.66
313 0.68
314 0.66
315 0.68
316 0.71
317 0.77
318 0.75
319 0.76