Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YHP9

Protein Details
Accession G8YHP9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
28-47AKPLAPKKLNKKVLKTVKRAHydrophilic
NLS Segment(s)
PositionSequence
29-68KPLAPKKLNKKVLKTVKRASKAKHVKRGVKEVVKALRKGE
Subcellular Location(s) cyto 21.5, cyto_nucl 13.333, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
IPR004037  Ribosomal_L7Ae_CS  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MAKKEKEGKVKEEEDNYDKRMAAVLPFAKPLAPKKLNKKVLKTVKRASKAKHVKRGVKEVVKALRKGEKGLVIIAGDISPPDVISHIPVLCEDCSVPYVFIPSKEDLGSAGATKRPTSCVMVIPGGGKNGKNASKVDEYKEGYDEAVKEIAVLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.52
4 0.45
5 0.4
6 0.34
7 0.3
8 0.24
9 0.19
10 0.21
11 0.21
12 0.2
13 0.21
14 0.21
15 0.2
16 0.22
17 0.26
18 0.3
19 0.34
20 0.4
21 0.49
22 0.6
23 0.69
24 0.72
25 0.75
26 0.75
27 0.79
28 0.81
29 0.79
30 0.77
31 0.76
32 0.78
33 0.76
34 0.7
35 0.7
36 0.72
37 0.72
38 0.74
39 0.73
40 0.72
41 0.72
42 0.77
43 0.74
44 0.68
45 0.61
46 0.57
47 0.56
48 0.52
49 0.48
50 0.42
51 0.4
52 0.36
53 0.35
54 0.31
55 0.26
56 0.22
57 0.21
58 0.19
59 0.12
60 0.11
61 0.1
62 0.08
63 0.05
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.05
72 0.07
73 0.06
74 0.07
75 0.07
76 0.09
77 0.08
78 0.09
79 0.08
80 0.07
81 0.08
82 0.08
83 0.08
84 0.06
85 0.09
86 0.1
87 0.11
88 0.13
89 0.13
90 0.15
91 0.14
92 0.15
93 0.12
94 0.13
95 0.12
96 0.1
97 0.11
98 0.12
99 0.13
100 0.14
101 0.14
102 0.16
103 0.18
104 0.2
105 0.21
106 0.21
107 0.24
108 0.23
109 0.23
110 0.23
111 0.21
112 0.2
113 0.21
114 0.17
115 0.18
116 0.23
117 0.26
118 0.27
119 0.27
120 0.3
121 0.37
122 0.4
123 0.42
124 0.44
125 0.43
126 0.43
127 0.43
128 0.38
129 0.3
130 0.3
131 0.25
132 0.2
133 0.18
134 0.15