Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LIY4

Protein Details
Accession A0A1U7LIY4   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-45DLTIRHRPFKNPNYKRPTQKRIKTLKQILSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 11.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MSPPNGSVPPYDSIDLTIRHRPFKNPNYKRPTQKRIKTLKQILSSTSRTDFPPDFPTYTNIEAPPSLFPPKKWCDITGLPASYVDPYTKLRYHNKEIFGVVRKMGVSNAQMFLELRGANVILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.31
5 0.31
6 0.37
7 0.39
8 0.43
9 0.5
10 0.58
11 0.65
12 0.66
13 0.73
14 0.75
15 0.81
16 0.85
17 0.85
18 0.86
19 0.85
20 0.84
21 0.84
22 0.85
23 0.86
24 0.86
25 0.84
26 0.81
27 0.77
28 0.7
29 0.62
30 0.58
31 0.5
32 0.42
33 0.35
34 0.29
35 0.23
36 0.26
37 0.23
38 0.2
39 0.24
40 0.23
41 0.23
42 0.22
43 0.25
44 0.23
45 0.24
46 0.23
47 0.18
48 0.16
49 0.15
50 0.14
51 0.13
52 0.12
53 0.15
54 0.14
55 0.15
56 0.22
57 0.25
58 0.3
59 0.31
60 0.29
61 0.31
62 0.32
63 0.37
64 0.36
65 0.33
66 0.27
67 0.26
68 0.25
69 0.2
70 0.18
71 0.13
72 0.1
73 0.12
74 0.17
75 0.19
76 0.25
77 0.33
78 0.4
79 0.49
80 0.53
81 0.53
82 0.51
83 0.51
84 0.51
85 0.48
86 0.42
87 0.34
88 0.29
89 0.26
90 0.24
91 0.22
92 0.2
93 0.17
94 0.18
95 0.2
96 0.18
97 0.19
98 0.19
99 0.19
100 0.19
101 0.16
102 0.13
103 0.12