Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LRE2

Protein Details
Accession A0A1U7LRE2    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
150-169LAEPIFKKRKGAKNIRKKRDBasic
NLS Segment(s)
PositionSequence
58-72IPRPAAKKPEPAKGK
156-169KKRKGAKNIRKKRD
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MSRSWCKYCKTFYTSTKLGQTQHDTSDRHKRQLARFIQELHKQQQTDPENRERLPRYIPRPAAKKPEPAKGKEIGERWVGPKEEDYIRPISEQEVTENTAPDEEKDKPNEIFGKRTRAVDYDKDDTEGLRDFQIVEKAMPMYILDDQKDLAEPIFKKRKGAKNIRKKRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.62
3 0.62
4 0.57
5 0.53
6 0.5
7 0.5
8 0.45
9 0.47
10 0.47
11 0.42
12 0.45
13 0.53
14 0.51
15 0.5
16 0.53
17 0.54
18 0.56
19 0.63
20 0.65
21 0.6
22 0.59
23 0.58
24 0.6
25 0.59
26 0.58
27 0.53
28 0.5
29 0.44
30 0.41
31 0.45
32 0.44
33 0.44
34 0.44
35 0.47
36 0.47
37 0.47
38 0.53
39 0.47
40 0.44
41 0.44
42 0.46
43 0.44
44 0.48
45 0.54
46 0.53
47 0.56
48 0.59
49 0.61
50 0.57
51 0.6
52 0.55
53 0.58
54 0.57
55 0.54
56 0.53
57 0.48
58 0.48
59 0.43
60 0.4
61 0.34
62 0.31
63 0.29
64 0.27
65 0.25
66 0.23
67 0.18
68 0.17
69 0.18
70 0.17
71 0.17
72 0.18
73 0.16
74 0.16
75 0.16
76 0.16
77 0.14
78 0.13
79 0.13
80 0.12
81 0.11
82 0.13
83 0.13
84 0.13
85 0.12
86 0.11
87 0.1
88 0.1
89 0.12
90 0.13
91 0.16
92 0.19
93 0.22
94 0.21
95 0.25
96 0.31
97 0.29
98 0.34
99 0.34
100 0.39
101 0.38
102 0.4
103 0.39
104 0.35
105 0.38
106 0.37
107 0.4
108 0.36
109 0.34
110 0.34
111 0.32
112 0.29
113 0.26
114 0.21
115 0.16
116 0.12
117 0.12
118 0.11
119 0.13
120 0.16
121 0.15
122 0.13
123 0.14
124 0.14
125 0.14
126 0.13
127 0.11
128 0.1
129 0.13
130 0.16
131 0.15
132 0.16
133 0.16
134 0.16
135 0.18
136 0.16
137 0.12
138 0.16
139 0.16
140 0.26
141 0.36
142 0.36
143 0.43
144 0.52
145 0.61
146 0.65
147 0.76
148 0.77
149 0.78