Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LUE2

Protein Details
Accession A0A1U7LUE2   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-29GSPLAAPQPRRPRRRRASSVVPTRKTPHydrophilic
NLS Segment(s)
PositionSequence
11-19PRRPRRRRA
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MLGSPLAAPQPRRPRRRRASSVVPTRKTPAVDTYPSKALVFSSAYTQQDDAQIPKSPSPKDPELRMIELYSPSKSWPSQDVLEELCRITRPPAYSNRPRQRQSFLKSPCQSSPSRKTSAVDLADLVSAAHLDRCPNSPQQQGWSITLRNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.87
4 0.87
5 0.85
6 0.86
7 0.86
8 0.9
9 0.89
10 0.81
11 0.73
12 0.68
13 0.63
14 0.53
15 0.45
16 0.41
17 0.36
18 0.39
19 0.39
20 0.39
21 0.39
22 0.38
23 0.36
24 0.29
25 0.23
26 0.19
27 0.17
28 0.13
29 0.14
30 0.17
31 0.18
32 0.19
33 0.19
34 0.18
35 0.19
36 0.2
37 0.18
38 0.16
39 0.19
40 0.19
41 0.22
42 0.26
43 0.24
44 0.26
45 0.31
46 0.35
47 0.35
48 0.37
49 0.41
50 0.4
51 0.4
52 0.37
53 0.31
54 0.26
55 0.25
56 0.23
57 0.16
58 0.13
59 0.12
60 0.13
61 0.12
62 0.13
63 0.13
64 0.15
65 0.15
66 0.16
67 0.17
68 0.17
69 0.18
70 0.17
71 0.14
72 0.11
73 0.1
74 0.1
75 0.1
76 0.12
77 0.13
78 0.17
79 0.26
80 0.34
81 0.43
82 0.54
83 0.62
84 0.68
85 0.69
86 0.69
87 0.68
88 0.69
89 0.65
90 0.64
91 0.6
92 0.62
93 0.62
94 0.62
95 0.57
96 0.53
97 0.51
98 0.5
99 0.54
100 0.5
101 0.51
102 0.48
103 0.47
104 0.47
105 0.5
106 0.42
107 0.33
108 0.28
109 0.24
110 0.22
111 0.2
112 0.16
113 0.08
114 0.06
115 0.06
116 0.07
117 0.07
118 0.09
119 0.11
120 0.14
121 0.18
122 0.25
123 0.31
124 0.36
125 0.38
126 0.42
127 0.47
128 0.48
129 0.48
130 0.46