Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y2V4

Protein Details
Accession G8Y2V4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
134-156IIAEKRPSYKKQIAKRNSKKIWWHydrophilic
NLS Segment(s)
PositionSequence
138-153KRPSYKKQIAKRNSKK
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSLSAKEAFKKLPEKLHNFFIKYPPRPFTEYSSKPSTISDPNMNPFLPNKNEETGKWHDPRFSLRRSADLFKMAYKFGIQDLLPPIPHKRFYADKYYNKNWMRGVLFQKKHKWERGFPEKLKERQEAIAKMDEIIAEKRPSYKKQIAKRNSKKIWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.65
4 0.64
5 0.61
6 0.59
7 0.59
8 0.59
9 0.58
10 0.6
11 0.54
12 0.53
13 0.53
14 0.53
15 0.51
16 0.52
17 0.5
18 0.5
19 0.53
20 0.49
21 0.45
22 0.44
23 0.4
24 0.35
25 0.35
26 0.35
27 0.32
28 0.34
29 0.36
30 0.34
31 0.31
32 0.28
33 0.29
34 0.25
35 0.24
36 0.24
37 0.25
38 0.26
39 0.26
40 0.3
41 0.3
42 0.34
43 0.36
44 0.34
45 0.33
46 0.33
47 0.41
48 0.4
49 0.37
50 0.38
51 0.34
52 0.38
53 0.4
54 0.41
55 0.35
56 0.32
57 0.3
58 0.24
59 0.25
60 0.2
61 0.16
62 0.13
63 0.12
64 0.09
65 0.11
66 0.08
67 0.09
68 0.12
69 0.12
70 0.12
71 0.13
72 0.16
73 0.16
74 0.19
75 0.17
76 0.18
77 0.23
78 0.26
79 0.35
80 0.41
81 0.47
82 0.53
83 0.56
84 0.62
85 0.58
86 0.58
87 0.49
88 0.45
89 0.4
90 0.38
91 0.43
92 0.43
93 0.47
94 0.51
95 0.58
96 0.62
97 0.66
98 0.69
99 0.67
100 0.64
101 0.69
102 0.72
103 0.74
104 0.68
105 0.71
106 0.71
107 0.72
108 0.7
109 0.64
110 0.56
111 0.53
112 0.57
113 0.5
114 0.45
115 0.43
116 0.37
117 0.34
118 0.31
119 0.26
120 0.21
121 0.2
122 0.2
123 0.17
124 0.17
125 0.25
126 0.3
127 0.35
128 0.42
129 0.49
130 0.53
131 0.62
132 0.72
133 0.75
134 0.8
135 0.86
136 0.88