Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y2K3

Protein Details
Accession G8Y2K3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
24-45LRAAQESKKKRASKKDASEVNYHydrophilic
NLS Segment(s)
PositionSequence
31-37KKKRASK
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009078  Ferritin-like_SF  
IPR011566  Ubq_synth_Coq7  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0008682  F:3-demethoxyubiquinol 3-hydroxylase activity  
GO:0046872  F:metal ion binding  
GO:0016709  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF03232  COQ7  
CDD cd01042  DMQH  
Amino Acid Sequences MLRKQCVKVTAPGALRNLSSSCALRAAQESKKKRASKKDASEVNYGALSKAQKAFLDRLIRVDQAGELGANYIYNGQYTVLASRYPHLRPVLQHMWDQEVHHHNTFNRLQTQRRVRPSLLTPLWKLGAFGMGAGTSLLSKEAAMACTVAVETVIGNHYNQQLRVLMNQYNVHVYDKKTGEPLDASQIKSSAECSPEISQLKELVSQFRDEELEHLDTAVEHDAEKAVPYILLTEAIKLMCKGAIWTAERI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.33
4 0.29
5 0.24
6 0.23
7 0.2
8 0.18
9 0.19
10 0.19
11 0.18
12 0.23
13 0.27
14 0.33
15 0.41
16 0.47
17 0.53
18 0.62
19 0.68
20 0.72
21 0.77
22 0.79
23 0.8
24 0.83
25 0.84
26 0.83
27 0.8
28 0.76
29 0.66
30 0.57
31 0.47
32 0.37
33 0.27
34 0.23
35 0.19
36 0.16
37 0.18
38 0.18
39 0.18
40 0.21
41 0.24
42 0.27
43 0.33
44 0.3
45 0.32
46 0.33
47 0.32
48 0.29
49 0.26
50 0.2
51 0.14
52 0.13
53 0.08
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.06
60 0.05
61 0.05
62 0.06
63 0.05
64 0.06
65 0.07
66 0.08
67 0.08
68 0.08
69 0.09
70 0.11
71 0.15
72 0.15
73 0.19
74 0.2
75 0.22
76 0.22
77 0.3
78 0.34
79 0.32
80 0.33
81 0.29
82 0.31
83 0.29
84 0.29
85 0.26
86 0.25
87 0.26
88 0.25
89 0.27
90 0.23
91 0.29
92 0.31
93 0.28
94 0.3
95 0.3
96 0.32
97 0.39
98 0.49
99 0.5
100 0.53
101 0.54
102 0.48
103 0.49
104 0.48
105 0.48
106 0.42
107 0.37
108 0.32
109 0.29
110 0.29
111 0.25
112 0.22
113 0.13
114 0.11
115 0.08
116 0.07
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.04
128 0.05
129 0.05
130 0.06
131 0.06
132 0.05
133 0.05
134 0.05
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.05
141 0.05
142 0.05
143 0.08
144 0.12
145 0.13
146 0.14
147 0.15
148 0.15
149 0.16
150 0.18
151 0.19
152 0.17
153 0.19
154 0.2
155 0.2
156 0.2
157 0.2
158 0.21
159 0.2
160 0.2
161 0.24
162 0.24
163 0.24
164 0.25
165 0.25
166 0.23
167 0.22
168 0.22
169 0.24
170 0.26
171 0.26
172 0.24
173 0.24
174 0.23
175 0.21
176 0.22
177 0.16
178 0.14
179 0.14
180 0.17
181 0.18
182 0.25
183 0.26
184 0.26
185 0.24
186 0.24
187 0.25
188 0.25
189 0.24
190 0.23
191 0.23
192 0.23
193 0.22
194 0.22
195 0.22
196 0.18
197 0.19
198 0.18
199 0.19
200 0.17
201 0.16
202 0.14
203 0.13
204 0.14
205 0.15
206 0.1
207 0.08
208 0.09
209 0.09
210 0.1
211 0.1
212 0.1
213 0.08
214 0.08
215 0.08
216 0.09
217 0.08
218 0.11
219 0.11
220 0.11
221 0.13
222 0.13
223 0.14
224 0.13
225 0.14
226 0.11
227 0.11
228 0.12
229 0.14
230 0.2