Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YK69

Protein Details
Accession G8YK69    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
118-141IFPSSFPQARRHNRRRSVALKFQSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031426  DUF4667  
Pfam View protein in Pfam  
PF15700  DUF4667  
Amino Acid Sequences MQRRFCLAIECKDNASNEPQTAFLVDLNKCEPQEVRQNGYRLLVASDPGSPIENPVKEDQSDAPRDSQAATSRRYSLCDLNTLDSEGSEESSPVRNKSTKLCCDDDVNESKPDVESPIFPSSFPQARRHNRRRSVALKFQSPKFYPDAEPPGSSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.33
4 0.29
5 0.27
6 0.25
7 0.23
8 0.22
9 0.2
10 0.16
11 0.17
12 0.16
13 0.17
14 0.19
15 0.21
16 0.2
17 0.21
18 0.2
19 0.19
20 0.29
21 0.31
22 0.34
23 0.37
24 0.39
25 0.39
26 0.39
27 0.35
28 0.26
29 0.23
30 0.18
31 0.13
32 0.12
33 0.11
34 0.1
35 0.1
36 0.11
37 0.09
38 0.11
39 0.16
40 0.15
41 0.17
42 0.19
43 0.2
44 0.19
45 0.21
46 0.22
47 0.22
48 0.25
49 0.24
50 0.23
51 0.21
52 0.21
53 0.2
54 0.19
55 0.2
56 0.2
57 0.21
58 0.21
59 0.24
60 0.24
61 0.26
62 0.26
63 0.23
64 0.21
65 0.23
66 0.22
67 0.2
68 0.2
69 0.18
70 0.16
71 0.12
72 0.12
73 0.08
74 0.08
75 0.06
76 0.06
77 0.06
78 0.12
79 0.13
80 0.14
81 0.17
82 0.18
83 0.2
84 0.29
85 0.36
86 0.38
87 0.42
88 0.44
89 0.43
90 0.44
91 0.45
92 0.42
93 0.39
94 0.35
95 0.3
96 0.27
97 0.26
98 0.22
99 0.2
100 0.17
101 0.13
102 0.12
103 0.16
104 0.2
105 0.2
106 0.2
107 0.21
108 0.25
109 0.3
110 0.31
111 0.35
112 0.4
113 0.51
114 0.62
115 0.71
116 0.75
117 0.79
118 0.84
119 0.85
120 0.83
121 0.82
122 0.81
123 0.78
124 0.77
125 0.74
126 0.71
127 0.71
128 0.64
129 0.59
130 0.52
131 0.49
132 0.42
133 0.44
134 0.47
135 0.41