Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1U7LIH7

Protein Details
Accession A0A1U7LIH7    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
104-131NDENSKDKSTKKTKVKPKVKLAFDNDNEHydrophilic
NLS Segment(s)
PositionSequence
92-95KRPK
111-121KSTKKTKVKPK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAGRDNPRNLAYQQDEPAFLKRLRAGKQAVPGSQDFRHKRAKVHDEDDAPLVVDLKHQDDPICDKIASATPSTNEFRTIPIKHAEATVGFKKRPKAIKTGSNINDENSKDKSTKKTKVKPKVKLAFDNDNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.34
4 0.37
5 0.34
6 0.29
7 0.28
8 0.29
9 0.34
10 0.36
11 0.4
12 0.41
13 0.4
14 0.48
15 0.49
16 0.46
17 0.42
18 0.4
19 0.38
20 0.37
21 0.42
22 0.37
23 0.37
24 0.46
25 0.44
26 0.47
27 0.53
28 0.58
29 0.55
30 0.56
31 0.56
32 0.49
33 0.48
34 0.44
35 0.34
36 0.25
37 0.18
38 0.15
39 0.09
40 0.08
41 0.08
42 0.09
43 0.1
44 0.1
45 0.11
46 0.11
47 0.16
48 0.17
49 0.18
50 0.15
51 0.14
52 0.15
53 0.17
54 0.18
55 0.14
56 0.12
57 0.11
58 0.15
59 0.17
60 0.16
61 0.15
62 0.14
63 0.16
64 0.21
65 0.21
66 0.2
67 0.22
68 0.22
69 0.21
70 0.21
71 0.19
72 0.15
73 0.19
74 0.23
75 0.24
76 0.24
77 0.27
78 0.31
79 0.38
80 0.45
81 0.43
82 0.45
83 0.49
84 0.56
85 0.58
86 0.64
87 0.62
88 0.6
89 0.57
90 0.5
91 0.48
92 0.41
93 0.39
94 0.32
95 0.31
96 0.27
97 0.31
98 0.4
99 0.44
100 0.53
101 0.59
102 0.66
103 0.74
104 0.83
105 0.89
106 0.89
107 0.9
108 0.89
109 0.87
110 0.86
111 0.83