Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LR84

Protein Details
Accession A0A1U7LR84   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-49AAKPHIPIVKKRTKKFNRHQSDRFKCVKSAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
11-48VKKRTKKFNRHQSDRFKCVKSAWRKPKGIDNRVRRRFK
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAAKPHIPIVKKRTKKFNRHQSDRFKCVKSAWRKPKGIDNRVRRRFKGQAAMPTIGCGSNKRTRHMMPSGHKVFLVRNVQDIELLLMHNRTFAAEIAHNISSKKRIDIVEKARALNVKVTNAAARLRKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.84
4 0.87
5 0.88
6 0.88
7 0.89
8 0.91
9 0.91
10 0.9
11 0.87
12 0.84
13 0.75
14 0.66
15 0.62
16 0.62
17 0.61
18 0.63
19 0.65
20 0.67
21 0.68
22 0.69
23 0.73
24 0.74
25 0.74
26 0.72
27 0.73
28 0.74
29 0.8
30 0.84
31 0.76
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.45
41 0.38
42 0.33
43 0.25
44 0.2
45 0.14
46 0.14
47 0.2
48 0.22
49 0.24
50 0.28
51 0.28
52 0.33
53 0.37
54 0.39
55 0.37
56 0.45
57 0.45
58 0.42
59 0.41
60 0.36
61 0.31
62 0.31
63 0.31
64 0.21
65 0.21
66 0.22
67 0.22
68 0.21
69 0.2
70 0.14
71 0.09
72 0.09
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.06
79 0.07
80 0.07
81 0.09
82 0.09
83 0.11
84 0.14
85 0.16
86 0.16
87 0.16
88 0.18
89 0.2
90 0.21
91 0.22
92 0.23
93 0.25
94 0.3
95 0.39
96 0.45
97 0.49
98 0.51
99 0.5
100 0.48
101 0.48
102 0.43
103 0.4
104 0.36
105 0.29
106 0.27
107 0.29
108 0.28
109 0.28
110 0.32
111 0.31