FuNGI

A0A1U7LPG4

Protein Details

Accession

A0A1U7LPG4

Localization Confidence

Medium

Confidence Score

10.2

NoLS Segment(s)

Position	Sequence	Protein Nature
49-76	SASHSLLQKKQRKSKSLHKYKIGSFRQF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 14, mito 7, cyto 6

Family & Domain DBs

InterPro	View protein in InterPro IPR002885 Pentatricopeptide_repeat IPR011990 TPR-like_helical_dom_sf
Gene Ontology	GO:0005739 C:mitochondrion
Pfam	View protein in Pfam PF01535 PPR

Amino Acid Sequences

MAISHDDTTLNSLKMFKGLLVLQSLGVRSYPLRLQSYNSSTGIIQRSFSASHSLLQKKQRKSKSLHKYKIGSFRQFIAASTTNPTLLQAIALLGTQTPISELNDKIFKIIHEDPSHSAAYTILVAGNRDNKDILSEIWIKAKAANVVTPYLASHLLRSFTRLKEFDAAFEIFKSEEVSPKTLIDMYNCAPDLTALNKVRDLTMKKIGESTLATKTFINQALIKNLAKFDLSAAHKLVSEMESPKVFLWKDIFQEAGNNRDADALYNAYKKYTESGFSLGDLEMFFYVALAKIYPEAMFAMAKMSGPPGELSANEKEMFDDTSADKPNRKPRMVQKFIYPLIGFLENGQYEKAQEVIEIANPEKKSRCLYLYSIYLSHLTRENKVDEALEWLEKMDSLKLGPFQPQYLALLIACNRRAETEQAEKIITAMQKKDFHIPRHLLPAEKVQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.21
3	0.16
4	0.16
5	0.18
6	0.19
7	0.2
8	0.2
9	0.19
10	0.2
11	0.2
12	0.17
13	0.15
14	0.14
15	0.12
16	0.15
17	0.18
18	0.22
19	0.26
20	0.27
21	0.32
22	0.39
23	0.44
24	0.45
25	0.42
26	0.37
27	0.33
28	0.38
29	0.39
30	0.31
31	0.26
32	0.22
33	0.24
34	0.24
35	0.25
36	0.25
37	0.2
38	0.23
39	0.31
40	0.36
41	0.4
42	0.5
43	0.57
44	0.61
45	0.7
46	0.75
47	0.75
48	0.77
49	0.81
50	0.82
51	0.84
52	0.84
53	0.83
54	0.81
55	0.8
56	0.83
57	0.81
58	0.76
59	0.67
60	0.61
61	0.58
62	0.51
63	0.43
64	0.39
65	0.33
66	0.27
67	0.29
68	0.27
69	0.22
70	0.21
71	0.21
72	0.15
73	0.13
74	0.11
75	0.07
76	0.06
77	0.06
78	0.06
79	0.06
80	0.05
81	0.05
82	0.05
83	0.05
84	0.05
85	0.06
86	0.09
87	0.12
88	0.13
89	0.17
90	0.21
91	0.21
92	0.21
93	0.2
94	0.18
95	0.22
96	0.26
97	0.29
98	0.28
99	0.31
100	0.33
101	0.35
102	0.35
103	0.28
104	0.24
105	0.16
106	0.15
107	0.12
108	0.1
109	0.08
110	0.08
111	0.08
112	0.1
113	0.17
114	0.17
115	0.18
116	0.18
117	0.16
118	0.17
119	0.18
120	0.16
121	0.15
122	0.17
123	0.17
124	0.21
125	0.21
126	0.2
127	0.2
128	0.22
129	0.19
130	0.17
131	0.18
132	0.16
133	0.16
134	0.16
135	0.15
136	0.13
137	0.12
138	0.12
139	0.1
140	0.1
141	0.11
142	0.13
143	0.13
144	0.17
145	0.2
146	0.21
147	0.27
148	0.26
149	0.26
150	0.3
151	0.31
152	0.27
153	0.27
154	0.25
155	0.2
156	0.19
157	0.17
158	0.11
159	0.11
160	0.12
161	0.09
162	0.12
163	0.14
164	0.16
165	0.16
166	0.16
167	0.17
168	0.16
169	0.16
170	0.13
171	0.14
172	0.13
173	0.15
174	0.15
175	0.15
176	0.13
177	0.12
178	0.12
179	0.1
180	0.17
181	0.16
182	0.17
183	0.18
184	0.18
185	0.19
186	0.23
187	0.24
188	0.21
189	0.27
190	0.27
191	0.27
192	0.28
193	0.27
194	0.24
195	0.22
196	0.21
197	0.18
198	0.18
199	0.18
200	0.17
201	0.18
202	0.2
203	0.19
204	0.18
205	0.15
206	0.15
207	0.17
208	0.2
209	0.19
210	0.16
211	0.15
212	0.14
213	0.11
214	0.1
215	0.09
216	0.12
217	0.14
218	0.15
219	0.15
220	0.15
221	0.15
222	0.15
223	0.16
224	0.1
225	0.11
226	0.1
227	0.11
228	0.11
229	0.12
230	0.12
231	0.14
232	0.13
233	0.13
234	0.15
235	0.15
236	0.17
237	0.17
238	0.18
239	0.14
240	0.2
241	0.19
242	0.2
243	0.19
244	0.17
245	0.16
246	0.17
247	0.17
248	0.12
249	0.13
250	0.11
251	0.11
252	0.14
253	0.14
254	0.13
255	0.13
256	0.13
257	0.14
258	0.14
259	0.14
260	0.13
261	0.16
262	0.16
263	0.16
264	0.17
265	0.14
266	0.13
267	0.1
268	0.09
269	0.06
270	0.06
271	0.05
272	0.04
273	0.04
274	0.04
275	0.04
276	0.04
277	0.04
278	0.05
279	0.05
280	0.05
281	0.06
282	0.06
283	0.06
284	0.06
285	0.06
286	0.07
287	0.07
288	0.07
289	0.06
290	0.07
291	0.06
292	0.07
293	0.07
294	0.08
295	0.08
296	0.09
297	0.13
298	0.14
299	0.16
300	0.16
301	0.16
302	0.15
303	0.15
304	0.16
305	0.12
306	0.12
307	0.12
308	0.16
309	0.21
310	0.23
311	0.26
312	0.32
313	0.42
314	0.49
315	0.49
316	0.52
317	0.58
318	0.68
319	0.7
320	0.65
321	0.63
322	0.63
323	0.61
324	0.58
325	0.48
326	0.37
327	0.32
328	0.31
329	0.23
330	0.15
331	0.19
332	0.14
333	0.15
334	0.15
335	0.12
336	0.12
337	0.13
338	0.13
339	0.08
340	0.08
341	0.09
342	0.09
343	0.12
344	0.14
345	0.14
346	0.18
347	0.19
348	0.22
349	0.23
350	0.25
351	0.27
352	0.29
353	0.31
354	0.3
355	0.34
356	0.36
357	0.39
358	0.38
359	0.35
360	0.32
361	0.32
362	0.27
363	0.26
364	0.27
365	0.25
366	0.26
367	0.29
368	0.3
369	0.28
370	0.29
371	0.28
372	0.21
373	0.24
374	0.23
375	0.19
376	0.17
377	0.16
378	0.15
379	0.15
380	0.16
381	0.12
382	0.11
383	0.11
384	0.13
385	0.16
386	0.18
387	0.23
388	0.24
389	0.24
390	0.25
391	0.26
392	0.25
393	0.22
394	0.22
395	0.16
396	0.18
397	0.2
398	0.24
399	0.24
400	0.24
401	0.23
402	0.25
403	0.28
404	0.29
405	0.32
406	0.36
407	0.38
408	0.39
409	0.4
410	0.37
411	0.34
412	0.34
413	0.31
414	0.27
415	0.27
416	0.32
417	0.36
418	0.39
419	0.49
420	0.52
421	0.53
422	0.58
423	0.59
424	0.57
425	0.62
426	0.62
427	0.55

A0A1U7LPG4

3D AlphaFold-predicted Structure Viewer