Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y4V1

Protein Details
Accession G8Y4V1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-114RLRTRNGRKILARRRAKGRWYBasic
NLS Segment(s)
PositionSequence
84-112KRKRTFGFLARLRTRNGRKILARRRAKGR
Subcellular Location(s) mito 17, mito_nucl 11.833, cyto_mito 10.833, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFWNTGLRIGRGLSAVMGGSSRQISFLSRPVVSNNIRSMEQGLTSKATITDTGIFNFLRVSTLFGAMQRRFKSLGNSYQPSTIKRKRTFGFLARLRTRNGRKILARRRAKGRWYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.08
5 0.06
6 0.07
7 0.08
8 0.08
9 0.08
10 0.09
11 0.11
12 0.13
13 0.18
14 0.2
15 0.2
16 0.21
17 0.22
18 0.28
19 0.28
20 0.3
21 0.28
22 0.26
23 0.26
24 0.25
25 0.26
26 0.19
27 0.19
28 0.16
29 0.14
30 0.13
31 0.13
32 0.13
33 0.11
34 0.11
35 0.09
36 0.09
37 0.11
38 0.1
39 0.11
40 0.12
41 0.12
42 0.11
43 0.11
44 0.09
45 0.07
46 0.07
47 0.08
48 0.07
49 0.09
50 0.09
51 0.11
52 0.16
53 0.17
54 0.23
55 0.22
56 0.23
57 0.24
58 0.24
59 0.29
60 0.29
61 0.36
62 0.38
63 0.4
64 0.39
65 0.43
66 0.44
67 0.42
68 0.46
69 0.44
70 0.47
71 0.49
72 0.56
73 0.52
74 0.58
75 0.61
76 0.58
77 0.61
78 0.57
79 0.62
80 0.62
81 0.63
82 0.59
83 0.62
84 0.62
85 0.6
86 0.6
87 0.58
88 0.6
89 0.68
90 0.75
91 0.76
92 0.78
93 0.78
94 0.81
95 0.81
96 0.8
97 0.79