Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LKP4

Protein Details
Accession A0A1U7LKP4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-103AASKVEKPSRQQRKQRKNRAAKLRGTAKVKHydrophilic
NLS Segment(s)
PositionSequence
73-110GAASKVEKPSRQQRKQRKNRAAKLRGTAKVKGPKAKKE
Subcellular Location(s) cyto 14, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVVDVLHPNRANVSKDELRAKLTELYKVSKDQVQCFGFRTQFGGGKSTGFALIYDSVEALKKFEPRYRLVRIGAASKVEKPSRQQRKQRKNRAAKLRGTAKVKGPKAKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.44
4 0.41
5 0.39
6 0.37
7 0.37
8 0.36
9 0.32
10 0.32
11 0.29
12 0.31
13 0.31
14 0.32
15 0.32
16 0.29
17 0.31
18 0.29
19 0.34
20 0.32
21 0.3
22 0.31
23 0.33
24 0.3
25 0.27
26 0.26
27 0.2
28 0.21
29 0.21
30 0.2
31 0.16
32 0.16
33 0.16
34 0.14
35 0.12
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.08
48 0.11
49 0.13
50 0.17
51 0.2
52 0.24
53 0.3
54 0.35
55 0.38
56 0.36
57 0.37
58 0.35
59 0.35
60 0.32
61 0.28
62 0.24
63 0.23
64 0.27
65 0.27
66 0.27
67 0.31
68 0.41
69 0.49
70 0.57
71 0.65
72 0.7
73 0.79
74 0.88
75 0.93
76 0.93
77 0.93
78 0.93
79 0.94
80 0.91
81 0.87
82 0.86
83 0.84
84 0.8
85 0.74
86 0.69
87 0.67
88 0.68
89 0.68
90 0.68