Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LJ91

Protein Details
Accession A0A1U7LJ91   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
46-68QLDGPERPRKKNRKVKLPPDEYVBasic
NLS Segment(s)
PositionSequence
52-61RPRKKNRKVK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.833, cyto 6, cyto_mito 4.833, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MLTGYQSGDHPLIIERPSSLVTSGESICSLPMQPNIADGATNAPVQLDGPERPRKKNRKVKLPPDEYVCASCGTTDSPEWRKGPMGPKTYHVPFRFKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.13
4 0.14
5 0.14
6 0.13
7 0.11
8 0.11
9 0.13
10 0.13
11 0.12
12 0.11
13 0.11
14 0.1
15 0.1
16 0.09
17 0.09
18 0.1
19 0.11
20 0.1
21 0.11
22 0.12
23 0.11
24 0.1
25 0.09
26 0.09
27 0.09
28 0.09
29 0.08
30 0.07
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.13
37 0.22
38 0.25
39 0.32
40 0.42
41 0.51
42 0.59
43 0.69
44 0.72
45 0.75
46 0.83
47 0.87
48 0.88
49 0.85
50 0.78
51 0.73
52 0.67
53 0.58
54 0.49
55 0.39
56 0.29
57 0.22
58 0.18
59 0.13
60 0.11
61 0.12
62 0.12
63 0.18
64 0.22
65 0.27
66 0.28
67 0.29
68 0.3
69 0.34
70 0.41
71 0.43
72 0.46
73 0.43
74 0.47
75 0.53
76 0.57
77 0.61
78 0.55