Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LWY8

Protein Details
Accession A0A1U7LWY8   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
244-265DPYVCFRRREIRQVRKTRRTDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024943  Enhancer_polycomb  
IPR019542  Enhancer_polycomb-like_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0032777  C:Piccolo NuA4 histone acetyltransferase complex  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF10513  EPL1  
Amino Acid Sequences MATKGGSARIRNRKISIKQYLTIIRGPDIPDIDEDSAFQRSATQIETGVDKDEEVVSHPPALPPKHHHLREHHLQAALASQAVATGPKPEHLYIPTPDASKKVKDYDVHYAKSFSQPTSYIRSSATVEDYEGCPYCMDEQDEAFLRKMISKRSKETDISEDVFELVMQFFEQITNENQPFLSLDPTNVSSFEELEKSLERCELSKYRSSAKSIYGHWRRRRLENAGKPLMPVLRFEENEKDEGDPYVCFRRREIRQVRKTRRTDAQSSEKLRKLRAEMIEARDLIAMVRDREKMRKDSLVMDHLIFNQRCTVKDVKRKLGIQGEDEDLVSHKIKKPRIQSEVGAIPLVRHAVLRHGSLRPEEPLIRLEDVRANKVRETELAVSEALGVEKALQAGWSDLSEISPVVTVARIPSNFTRDVSFIPVEPQEVLSSTSQDLPLSNSLLSNAFSFKTRLNRFQITRLPISRRTGRSNRTLVECPMYLRSRTLCGELHDERARDRIKYDFDPFDYDDVVNVDNAGDNSIRFQAWLMKEALDDPVFGSQSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.77
4 0.73
5 0.68
6 0.69
7 0.68
8 0.62
9 0.57
10 0.49
11 0.4
12 0.37
13 0.36
14 0.33
15 0.28
16 0.25
17 0.23
18 0.26
19 0.25
20 0.22
21 0.21
22 0.19
23 0.2
24 0.18
25 0.16
26 0.14
27 0.13
28 0.15
29 0.16
30 0.14
31 0.14
32 0.15
33 0.17
34 0.16
35 0.18
36 0.16
37 0.14
38 0.15
39 0.14
40 0.13
41 0.14
42 0.16
43 0.15
44 0.17
45 0.18
46 0.2
47 0.26
48 0.29
49 0.31
50 0.35
51 0.44
52 0.52
53 0.57
54 0.61
55 0.63
56 0.69
57 0.73
58 0.73
59 0.67
60 0.58
61 0.52
62 0.45
63 0.39
64 0.31
65 0.21
66 0.13
67 0.08
68 0.07
69 0.07
70 0.08
71 0.06
72 0.1
73 0.1
74 0.13
75 0.17
76 0.17
77 0.2
78 0.23
79 0.27
80 0.25
81 0.3
82 0.3
83 0.29
84 0.29
85 0.31
86 0.32
87 0.32
88 0.34
89 0.34
90 0.37
91 0.39
92 0.43
93 0.49
94 0.53
95 0.51
96 0.48
97 0.45
98 0.41
99 0.44
100 0.41
101 0.31
102 0.27
103 0.26
104 0.28
105 0.34
106 0.33
107 0.28
108 0.26
109 0.27
110 0.26
111 0.26
112 0.25
113 0.18
114 0.17
115 0.18
116 0.18
117 0.18
118 0.17
119 0.15
120 0.12
121 0.12
122 0.13
123 0.14
124 0.15
125 0.14
126 0.13
127 0.16
128 0.19
129 0.2
130 0.18
131 0.17
132 0.15
133 0.19
134 0.21
135 0.28
136 0.35
137 0.39
138 0.45
139 0.5
140 0.55
141 0.54
142 0.55
143 0.51
144 0.47
145 0.43
146 0.37
147 0.31
148 0.26
149 0.23
150 0.18
151 0.13
152 0.07
153 0.05
154 0.05
155 0.05
156 0.04
157 0.05
158 0.05
159 0.07
160 0.09
161 0.14
162 0.15
163 0.15
164 0.15
165 0.15
166 0.15
167 0.14
168 0.15
169 0.1
170 0.1
171 0.12
172 0.14
173 0.14
174 0.14
175 0.14
176 0.11
177 0.11
178 0.12
179 0.11
180 0.09
181 0.1
182 0.12
183 0.12
184 0.12
185 0.13
186 0.13
187 0.12
188 0.18
189 0.21
190 0.23
191 0.28
192 0.3
193 0.35
194 0.38
195 0.4
196 0.37
197 0.37
198 0.37
199 0.35
200 0.44
201 0.47
202 0.53
203 0.57
204 0.64
205 0.63
206 0.65
207 0.67
208 0.66
209 0.67
210 0.66
211 0.68
212 0.63
213 0.59
214 0.53
215 0.49
216 0.42
217 0.31
218 0.24
219 0.19
220 0.19
221 0.19
222 0.21
223 0.25
224 0.23
225 0.24
226 0.23
227 0.2
228 0.16
229 0.16
230 0.15
231 0.1
232 0.1
233 0.18
234 0.21
235 0.21
236 0.22
237 0.3
238 0.33
239 0.43
240 0.52
241 0.54
242 0.61
243 0.72
244 0.8
245 0.82
246 0.82
247 0.78
248 0.75
249 0.69
250 0.65
251 0.61
252 0.6
253 0.57
254 0.58
255 0.59
256 0.55
257 0.51
258 0.46
259 0.42
260 0.36
261 0.34
262 0.31
263 0.31
264 0.31
265 0.33
266 0.34
267 0.32
268 0.29
269 0.22
270 0.2
271 0.14
272 0.12
273 0.1
274 0.08
275 0.1
276 0.13
277 0.15
278 0.2
279 0.24
280 0.26
281 0.28
282 0.3
283 0.29
284 0.31
285 0.33
286 0.31
287 0.29
288 0.25
289 0.23
290 0.22
291 0.27
292 0.21
293 0.19
294 0.2
295 0.2
296 0.2
297 0.24
298 0.3
299 0.3
300 0.39
301 0.46
302 0.48
303 0.53
304 0.53
305 0.54
306 0.54
307 0.48
308 0.41
309 0.37
310 0.31
311 0.26
312 0.25
313 0.2
314 0.13
315 0.14
316 0.12
317 0.12
318 0.16
319 0.21
320 0.26
321 0.32
322 0.4
323 0.47
324 0.52
325 0.53
326 0.5
327 0.49
328 0.47
329 0.42
330 0.33
331 0.25
332 0.19
333 0.15
334 0.15
335 0.09
336 0.06
337 0.06
338 0.11
339 0.13
340 0.15
341 0.17
342 0.19
343 0.2
344 0.22
345 0.23
346 0.2
347 0.21
348 0.2
349 0.19
350 0.19
351 0.2
352 0.2
353 0.18
354 0.18
355 0.2
356 0.21
357 0.25
358 0.28
359 0.27
360 0.26
361 0.28
362 0.28
363 0.24
364 0.27
365 0.24
366 0.21
367 0.2
368 0.19
369 0.17
370 0.16
371 0.15
372 0.09
373 0.06
374 0.05
375 0.04
376 0.05
377 0.05
378 0.05
379 0.05
380 0.05
381 0.06
382 0.07
383 0.06
384 0.07
385 0.07
386 0.07
387 0.07
388 0.07
389 0.06
390 0.06
391 0.06
392 0.05
393 0.05
394 0.05
395 0.07
396 0.12
397 0.11
398 0.15
399 0.18
400 0.23
401 0.24
402 0.25
403 0.25
404 0.22
405 0.24
406 0.25
407 0.22
408 0.18
409 0.19
410 0.19
411 0.18
412 0.17
413 0.16
414 0.12
415 0.12
416 0.14
417 0.12
418 0.13
419 0.13
420 0.14
421 0.14
422 0.14
423 0.13
424 0.14
425 0.16
426 0.16
427 0.15
428 0.13
429 0.13
430 0.14
431 0.15
432 0.13
433 0.12
434 0.11
435 0.13
436 0.14
437 0.17
438 0.26
439 0.32
440 0.38
441 0.44
442 0.52
443 0.53
444 0.6
445 0.64
446 0.6
447 0.62
448 0.61
449 0.6
450 0.58
451 0.62
452 0.63
453 0.61
454 0.64
455 0.65
456 0.65
457 0.68
458 0.68
459 0.65
460 0.63
461 0.61
462 0.55
463 0.51
464 0.45
465 0.39
466 0.39
467 0.38
468 0.32
469 0.32
470 0.31
471 0.31
472 0.32
473 0.33
474 0.28
475 0.28
476 0.35
477 0.34
478 0.4
479 0.4
480 0.39
481 0.37
482 0.43
483 0.42
484 0.35
485 0.35
486 0.34
487 0.36
488 0.41
489 0.46
490 0.44
491 0.44
492 0.48
493 0.48
494 0.43
495 0.39
496 0.32
497 0.27
498 0.22
499 0.2
500 0.14
501 0.13
502 0.1
503 0.1
504 0.1
505 0.11
506 0.1
507 0.09
508 0.12
509 0.14
510 0.14
511 0.12
512 0.13
513 0.19
514 0.21
515 0.25
516 0.24
517 0.23
518 0.24
519 0.25
520 0.29
521 0.21
522 0.19
523 0.16
524 0.19
525 0.19