Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1U7LUW7

Protein Details
Accession A0A1U7LUW7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MIPSPPKKNKNKSTASGDKSHydrophilic
NLS Segment(s)
PositionSequence
26-41KSGGTKKRKKKGKTAG
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MIPSPPKKNKNKSTASGDKSEVTESKSGGTKKRKKKGKTAGLAEMLAKSKMQKESAAGKTWKNGRLVNIIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.76
3 0.7
4 0.62
5 0.54
6 0.46
7 0.42
8 0.33
9 0.25
10 0.22
11 0.18
12 0.18
13 0.2
14 0.22
15 0.27
16 0.36
17 0.43
18 0.52
19 0.61
20 0.68
21 0.68
22 0.77
23 0.79
24 0.79
25 0.78
26 0.73
27 0.7
28 0.63
29 0.59
30 0.48
31 0.39
32 0.3
33 0.22
34 0.16
35 0.12
36 0.14
37 0.17
38 0.18
39 0.18
40 0.21
41 0.3
42 0.35
43 0.41
44 0.39
45 0.38
46 0.44
47 0.49
48 0.5
49 0.45
50 0.44
51 0.41