Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LWR8

Protein Details
Accession A0A1U7LWR8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-137KGPMFEKILDRRRQRHKKRVTSKHYQTVLRBasic
NLS Segment(s)
PositionSequence
118-126RRRQRHKKR
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MSKSIKEIVRNGFNYTATYLKNIFTSIGGLKSQPNHYAVLHIHDRPYLLTENDQLTVPFNMKPLHRPGQIIRLTHCSKLGSRDFTIQGNPWIDNKLFTARAVVLEITKGPMFEKILDRRRQRHKKRVTSKHYQTVLRICELKIADELETSGSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.31
4 0.23
5 0.24
6 0.21
7 0.19
8 0.19
9 0.18
10 0.16
11 0.13
12 0.15
13 0.14
14 0.15
15 0.14
16 0.14
17 0.17
18 0.2
19 0.23
20 0.23
21 0.23
22 0.23
23 0.22
24 0.25
25 0.23
26 0.25
27 0.26
28 0.24
29 0.23
30 0.22
31 0.22
32 0.18
33 0.2
34 0.17
35 0.14
36 0.14
37 0.16
38 0.17
39 0.17
40 0.17
41 0.14
42 0.13
43 0.13
44 0.13
45 0.1
46 0.11
47 0.13
48 0.13
49 0.17
50 0.22
51 0.27
52 0.27
53 0.29
54 0.29
55 0.36
56 0.39
57 0.36
58 0.32
59 0.33
60 0.33
61 0.32
62 0.31
63 0.23
64 0.2
65 0.25
66 0.26
67 0.23
68 0.22
69 0.24
70 0.25
71 0.24
72 0.25
73 0.2
74 0.2
75 0.18
76 0.17
77 0.15
78 0.16
79 0.15
80 0.14
81 0.15
82 0.15
83 0.14
84 0.13
85 0.15
86 0.13
87 0.13
88 0.13
89 0.12
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.09
96 0.08
97 0.1
98 0.11
99 0.13
100 0.2
101 0.28
102 0.37
103 0.45
104 0.52
105 0.59
106 0.69
107 0.78
108 0.81
109 0.83
110 0.85
111 0.88
112 0.91
113 0.94
114 0.91
115 0.91
116 0.9
117 0.89
118 0.85
119 0.77
120 0.72
121 0.68
122 0.63
123 0.57
124 0.5
125 0.4
126 0.39
127 0.36
128 0.32
129 0.26
130 0.24
131 0.2
132 0.18
133 0.18