Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LRA5

Protein Details
Accession A0A1U7LRA5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
166-191GSWLSQTRRKRVRGVGKQKKIAKGIFHydrophilic
NLS Segment(s)
PositionSequence
173-188RRKRVRGVGKQKKIAK
Subcellular Location(s) extr 6, E.R. 5, cyto 4, golg 4, nucl 3, plas 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MLCLLHILVPLGCLLAHITAVDPIGDPGSTSTDDSQLELDLDSVIDSWFKDEEYMIHSPQNLKIPPVVDHDETGTTSSSLTTTQDYEDIYYRVSNTLQPLFINHAPPQPDVSRPTVFEILKSPELEINRPTARRLKGEYDIVDETPTWMKKDSERVRIVSTRLQDGSWLSQTRRKRVRGVGKQKKIAKGIFTEIKEEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.07
6 0.07
7 0.08
8 0.08
9 0.07
10 0.07
11 0.08
12 0.07
13 0.07
14 0.07
15 0.1
16 0.11
17 0.12
18 0.13
19 0.15
20 0.16
21 0.16
22 0.16
23 0.13
24 0.12
25 0.11
26 0.1
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.08
40 0.12
41 0.15
42 0.15
43 0.16
44 0.17
45 0.18
46 0.21
47 0.27
48 0.23
49 0.21
50 0.22
51 0.22
52 0.22
53 0.26
54 0.27
55 0.21
56 0.21
57 0.21
58 0.2
59 0.19
60 0.18
61 0.13
62 0.09
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.09
72 0.09
73 0.09
74 0.1
75 0.1
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.1
83 0.11
84 0.11
85 0.11
86 0.11
87 0.15
88 0.16
89 0.17
90 0.15
91 0.17
92 0.18
93 0.18
94 0.21
95 0.17
96 0.18
97 0.19
98 0.22
99 0.21
100 0.2
101 0.23
102 0.25
103 0.24
104 0.22
105 0.22
106 0.22
107 0.23
108 0.22
109 0.2
110 0.18
111 0.19
112 0.2
113 0.18
114 0.2
115 0.21
116 0.22
117 0.24
118 0.28
119 0.3
120 0.32
121 0.35
122 0.35
123 0.36
124 0.4
125 0.38
126 0.36
127 0.35
128 0.31
129 0.28
130 0.22
131 0.2
132 0.2
133 0.19
134 0.16
135 0.16
136 0.17
137 0.2
138 0.31
139 0.37
140 0.42
141 0.46
142 0.47
143 0.51
144 0.53
145 0.53
146 0.47
147 0.42
148 0.38
149 0.34
150 0.31
151 0.27
152 0.26
153 0.28
154 0.28
155 0.29
156 0.26
157 0.32
158 0.39
159 0.48
160 0.54
161 0.54
162 0.56
163 0.63
164 0.72
165 0.77
166 0.82
167 0.83
168 0.84
169 0.88
170 0.87
171 0.84
172 0.8
173 0.73
174 0.66
175 0.6
176 0.59
177 0.57
178 0.52