Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1U7LVR6

Protein Details
Accession A0A1U7LVR6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-113DIANLKKKLEKRPKLRELDGBasic
NLS Segment(s)
PositionSequence
100-106KKLEKRP
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012471  DUF1690  
Pfam View protein in Pfam  
PF07956  DUF1690  
Amino Acid Sequences MGNSQSASSQPYVVQNPRSYPIGLSSVLVEHLDSKKADISRGITLESHIQSRVHAELKRLELLESEAFERQASELSKINIENDSGLNSTILSNDIANLKKKLEKRPKLRELDGVNQVRENLVGCLKLHEHRPLECWKEVEDFKYGQIIFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.39
4 0.41
5 0.42
6 0.36
7 0.31
8 0.29
9 0.26
10 0.23
11 0.2
12 0.17
13 0.15
14 0.15
15 0.14
16 0.11
17 0.11
18 0.12
19 0.14
20 0.13
21 0.14
22 0.18
23 0.18
24 0.2
25 0.19
26 0.21
27 0.22
28 0.23
29 0.23
30 0.18
31 0.19
32 0.23
33 0.21
34 0.19
35 0.16
36 0.15
37 0.15
38 0.17
39 0.18
40 0.18
41 0.18
42 0.19
43 0.22
44 0.24
45 0.26
46 0.24
47 0.21
48 0.17
49 0.18
50 0.17
51 0.13
52 0.12
53 0.1
54 0.1
55 0.1
56 0.1
57 0.07
58 0.09
59 0.09
60 0.1
61 0.11
62 0.11
63 0.13
64 0.13
65 0.14
66 0.12
67 0.11
68 0.1
69 0.08
70 0.09
71 0.08
72 0.08
73 0.07
74 0.07
75 0.07
76 0.06
77 0.07
78 0.06
79 0.05
80 0.06
81 0.1
82 0.12
83 0.14
84 0.15
85 0.16
86 0.22
87 0.27
88 0.37
89 0.45
90 0.53
91 0.61
92 0.71
93 0.79
94 0.8
95 0.78
96 0.75
97 0.7
98 0.67
99 0.66
100 0.59
101 0.5
102 0.44
103 0.41
104 0.33
105 0.27
106 0.21
107 0.13
108 0.11
109 0.12
110 0.11
111 0.14
112 0.17
113 0.2
114 0.23
115 0.29
116 0.31
117 0.31
118 0.36
119 0.41
120 0.44
121 0.45
122 0.42
123 0.37
124 0.4
125 0.41
126 0.38
127 0.34
128 0.3
129 0.27
130 0.32