Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1U7LMF9

Protein Details
Accession A0A1U7LMF9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-42PALTARRRPRHLRPHLPRQAAQEPPRHHRHPLPPLQNTRKGMHydrophilic
NLS Segment(s)
PositionSequence
6-18RRRPRHLRPHLPR
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, mito 5
Family & Domain DBs
Gene Ontology GO:0007229  P:integrin-mediated signaling pathway  
Amino Acid Sequences PALTARRRPRHLRPHLPRQAAQEPPRHHRHPLPPLQNTRKGMPDSPDIPVTPDTAHIQPSPIQPPQPDTKAQLVAAQQALLPSAPPCPPGQCHPVQPSVPANPDDFDILSQIDPRKPSIPQQADLRSRASAPLDPSSSTRPPDITVPAEEELYLPAYEPRDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.88
4 0.81
5 0.78
6 0.74
7 0.72
8 0.68
9 0.66
10 0.62
11 0.63
12 0.68
13 0.63
14 0.61
15 0.6
16 0.64
17 0.65
18 0.69
19 0.7
20 0.7
21 0.78
22 0.8
23 0.8
24 0.73
25 0.65
26 0.61
27 0.55
28 0.49
29 0.42
30 0.4
31 0.34
32 0.34
33 0.33
34 0.27
35 0.26
36 0.24
37 0.21
38 0.15
39 0.15
40 0.15
41 0.14
42 0.16
43 0.14
44 0.15
45 0.17
46 0.2
47 0.22
48 0.21
49 0.22
50 0.2
51 0.24
52 0.27
53 0.27
54 0.26
55 0.25
56 0.26
57 0.26
58 0.25
59 0.24
60 0.2
61 0.19
62 0.18
63 0.14
64 0.11
65 0.1
66 0.09
67 0.06
68 0.06
69 0.04
70 0.06
71 0.06
72 0.07
73 0.08
74 0.09
75 0.11
76 0.14
77 0.2
78 0.2
79 0.25
80 0.27
81 0.31
82 0.29
83 0.31
84 0.3
85 0.28
86 0.28
87 0.25
88 0.22
89 0.18
90 0.18
91 0.16
92 0.13
93 0.11
94 0.09
95 0.08
96 0.08
97 0.11
98 0.12
99 0.14
100 0.15
101 0.17
102 0.19
103 0.19
104 0.26
105 0.34
106 0.36
107 0.38
108 0.45
109 0.51
110 0.54
111 0.54
112 0.5
113 0.4
114 0.36
115 0.34
116 0.29
117 0.23
118 0.23
119 0.26
120 0.25
121 0.25
122 0.28
123 0.32
124 0.33
125 0.32
126 0.3
127 0.26
128 0.27
129 0.29
130 0.31
131 0.28
132 0.26
133 0.28
134 0.27
135 0.26
136 0.24
137 0.21
138 0.17
139 0.16
140 0.14
141 0.1
142 0.12