Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y319

Protein Details
Accession G8Y319    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-112STQVQNTKKLPNEKNKRLVTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, plas 6, pero 4, golg 4, mito 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MAFYVTLRVLCLLVCYLKNSWMLGGFTNAKGSQIRNSFKHDIFSSHKPQDHSCLKNKNSKSSTFHARLNLESRAESINEFFVAWNRARCAFVSTQVQNTKKLPNEKNKRLVTDQWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.18
5 0.2
6 0.19
7 0.18
8 0.17
9 0.18
10 0.15
11 0.19
12 0.18
13 0.17
14 0.19
15 0.18
16 0.18
17 0.18
18 0.19
19 0.21
20 0.27
21 0.31
22 0.31
23 0.39
24 0.43
25 0.42
26 0.44
27 0.38
28 0.36
29 0.36
30 0.4
31 0.4
32 0.4
33 0.42
34 0.4
35 0.4
36 0.44
37 0.45
38 0.44
39 0.44
40 0.48
41 0.48
42 0.55
43 0.55
44 0.56
45 0.51
46 0.51
47 0.49
48 0.45
49 0.5
50 0.45
51 0.46
52 0.41
53 0.39
54 0.37
55 0.35
56 0.33
57 0.25
58 0.22
59 0.21
60 0.17
61 0.16
62 0.14
63 0.11
64 0.1
65 0.09
66 0.09
67 0.08
68 0.09
69 0.12
70 0.13
71 0.15
72 0.16
73 0.18
74 0.18
75 0.19
76 0.21
77 0.2
78 0.23
79 0.29
80 0.29
81 0.35
82 0.42
83 0.44
84 0.43
85 0.44
86 0.47
87 0.46
88 0.54
89 0.55
90 0.58
91 0.68
92 0.73
93 0.81
94 0.8
95 0.79
96 0.75